triangle PDBeMotif: 1gwp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification viral protein    | release date: Fri, Mar 22, 2002
Title structure of the n-terminal domain of the mature hiv-1 capsid protein
Authors B.M.LEE, C.TANG, J.WALKER, M.F.SUMMERS, R.K.GITTI, S.YOO, W.I.SUNDQUIST
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW
DRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  ||  |||        |  |   | |||| |||||| | || ||||||  ||| |||||                |||| ||||||  | ||||||       |  |||  ||||||||||| |   
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  ||  |||        |  |   ^***|| |||||| | || |||||^***|| |||||                |||| |||||^*** ||||||       |  |||  ||||||||||| |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  ||  |||        |  |   | | || |||||^***** ||||||  ||| |||||                |^*****|||     ||||||       |  |||  ||||||||||| |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  |*****|        |  |   | | |*******| | ********************                | || |||||     *****|       ******************| |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |        ****   | | *******|| | ************ ******                 *******|||     *****|       **** ************ | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |               | |     |  || |                                          |||||       |  |                      |  ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***               | |     |  |***                                          ****|       |  |                      |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                      ****     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^** |  ||||||||          |  |   | ||| ||||||| | |||| |||| ||||  ||                   | | ||||||||||||| ||       | ||||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                   |  ||||||||          |  |   ^***| ||||||| | |||| |||^***||  ||                   | | |||||^***|||| ||       | ||||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                   |  ||||||||          |  |   | | | ||||||^*****|| |||| ||||  ||                   ^*****||| || |||| ||       | ||||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   ***********          |  |   | | | ******| | | ****************                     | ||||| ******| ||       *****************       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ***********          ****   | | ********| | ************ ****                      ****||| *********|       ****************        
search RasMol script viewer Motif-ligand binding stats  nest ..                                               | |     |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  ||  ||||  |   |  || | |  | | |||||| | || ||||||  ||   |  ||                | ||||||||  |  || ||       |  |||  ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  ||  ||||  |   |  || | ^*** | |||||| | || |||||^***|   |  ||                | |||||||^***  || ||       |  |||  ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  ||  ||||  |   |  || |      | |||||^***** ||||||  ||   |  ||                ^*****|||   |  || ||       |  |||  ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  |*****||  |   ***** |      *******| | *************   *****                *****||||   ***** ||       *****************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |****   ****| |      ******|| | ************    ****                 ******|||   *******|       **** **** ********      
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           ***         |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ****                                              ****       ****                               

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  || || ||  |           | ||||||||||| | |||||||||  ||   |  ||    | |         ||||||||||| ||||| ||       |  |||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  || || ||  |           ^***||||||||| | ||||||||^***|   |  ||    | |         |||||||||^***|||| ||       |  |||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  || || ||  |           | | ||||||||^*****|||||||  ||   |  ||    | |         ^*****||| |  |||| ||       |  |||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      ******** ||  |           | | *******|| | *************   *****    | |         *****|||| *****|| ||       *****************       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |****           | | ****** || | ******* ****    ****     | |         ******||| **** ****|       **** ***********        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |               | |     |  || |                          ***             |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***               | |     |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^** |  |  || |||||  |    |  |   | ||    |  ||  ||||||||||  ||  ||  ||         | |    ||||||||||||||||||||       | ||||| ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                   |  |  || |||||  |    |  |   ^***    |  ||  |||||||||^***|  ||  ||         | |    |||||||||^***|||||||       | ||||| ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                   |  |  || |||||  |    |  |   | |     |  |^*****|||||||  ||  ||  ||         | |    ^*****||| || |||||||       | ||||| ||||||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |  |  ******||  |    |  |   | |     |  |   **********************         | |    *****|||| *********|       *****************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   *********** |****    ****   | |     |  |   *********************          | |    ******||| **********       ******************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |               | |     |  |                                  ***        |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***               | |     |  |                                             ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |||||||| ||  |   |  || | |  |   || |||  |||||||||| |||   |  ||    | |         | ||||||||  |  || ||       | |||||||||||||||||     
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |||||||| ||  |   |  || | ^***   || |||  |||||||||^***|   |  ||    | |         | |||||||^***  || ||       | |||||||||||||||||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |||||||| ||  |   |  || |        || ||^*****||||||| |||   |  ||    | |         ^*****|||      || ||       | |||||||||||||||||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      ******** ||  |   ***** |        || ||   **************   *****    | |         *****||||      || ||       *****************||     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |****   ****| |        ****|   *************    ****     | |         ******|||      ****|       *******************     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |           | |         |  |                             ***             |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           ***         |  |                                             ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ****                                              ****       ****                               

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  ||  |||       |  || | |  | | |||||| | || |||||| ||||  || ||    | |         ||||||||||||||||||||       | ||||| ||| |||||       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  ||  |||       |  || | ^*** | |||||| | || |||||^***||  || ||    | |         |||||||||^***|||||||       | ||||| ||| |||||       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  ||  |||       |  || |      | |||||^***** |||||| ||||  || ||    | |         ^*****||||||||||||||       | ||||| ||| |||||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  |*****|       ***** |      *******| | *********************    | |         ******|||**********|       *****************       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |       ****| |      ******|| | ************ *******     | |         ******|||**********|       ********* ******        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |           | |         |  || |                          ***             |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           ***         |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ****                                              ****       ****                               

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |||||||| ||  |   || || | | || || |||||   || |||||| ||||||||  |                | | ||||||||||||| ||         |  || ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |||||||| ||  |   || || | ^*** || |||||   || |||||^***||||||  |                | | |||||^***|||| ||         |  || ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |||||||| ||  |   || || | | |  || ||||^***** |||||| ||||||||  |                ^*****||| ||||||| ||         |  || ||||||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      ******** ||  |   ***** | | |  ******|    *****************|  |                  | ||||| ******* ||         ***************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |****   ***** | | |  ***** |    **************** ****                  ****||| *********|         ****************      
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           *** | |     |  |                     |  |                    ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                     ****                     ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^** |  | ||||||      |   |  |   | |||| |||||| | || |||||| ||||||||| |                ||||||||||| ||||| ||        |  ||  ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                   |  | ||||||      |   |  |   ^***|| |||||| | || |||||^***||||||| |                |||||||||^***|||| ||        |  ||  ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                   |  | ||||||      |   |  |   | | || |||||^***** |||||| ||||||||| |                ^*****||| |  |||| ||        |  ||  ||||||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |  ********      |   |  |   | | ********| | ******************| |                 |||||||| *****|| ||        ****************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ***********      |   ****   | | *******|| | *********************                 |****||| **** ****|        *****************      
search RasMol script viewer Motif-ligand binding stats  nest ..                                    |   |      | |     |  |***                  |  |                 *******|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                    |   |      | |     ****                     ****                     ****       ****                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                    *****      | |                                                                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..    | |||      ^**    |||||||| ||  |    |  |   | || |||||||| | || || ||| ||||||||                   | | ||||||  |  || ||         |  || ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..    | |||             |||||||| ||  |    |  |   ^*** |||||||| | || || ||^***||||||                   | | |||||^***  || ||         |  || ||||||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..    | |||             |||||||| ||  |    |  |   | || |||||||^***** || ||| ||||||||                   ^*****|||   |  || ||         |  || ||||||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |||             ******** ||  |    |  |   | |********|| | ******************                     | |||||   ***** ||         ***************|      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    *****             |||||||| ||  |    |  |   | || || || || | |  |  ||| || || |                      | |||||   |  || ||         |  |  | |||||| |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|             ******** |****    ****   | |******* || | *****************                      ****|||   *******|         ****************      
search RasMol script viewer Motif-ligand binding stats  nest ..      ***                    ***               | |     |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    | |||||| ||  |   |  || | | |||| |||||| |||||||||||  ||   || ||         | |    | ||||||||| ||||| ||       | ||||| ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      | |||||| ||  |   |  || | ^***|| |||||| ||||||||||^***|   || ||         | |    | |||||||^***|||| ||       | ||||| ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      | |||||| ||  |   |  || | | | || |||||^*****|||||||  ||   || ||         | |    ^*****||| | ||||| ||       | ||||| ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      ******** ||  |   ***** | | | ********| |**************   *****         | |    *****|||| ******* ||       *****************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |****   ****| | | | *******|| |*************    *****         | |    ******||| *********|       ********* ********      
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           *** | |     |  |***                               ***        ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    | |||||| |     |  |  |   | || | |||||| | || ||||||  |||  ||                   ||| |||||| || ||| ||         |  || |||||||||| | |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      | |||||| |     |  |  |   ^*** | |||||| | || |||||^***||  ||                   ||| |||||^*** ||| ||         |  || |||||||||| | |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      | |||||| |     |  |  |   | |  | |||||^***** ||||||  |||  ||                   ^*****|||  |  ||| ||         |  || |||||||||| | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      ******** |     |  |  |   | |  *******| | ******************                    *****|||  *****| ||         ***************| | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |     *******   | |  *******| | ************ ****                     *****|||  ********|         **************** | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |               | |     |  || |                                          |||||       |  |                          ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***               | |     |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  |  || |       |  || | | || | |||||| | || ||||||  |||||||||     | |      | || | ||||||||||||||||       | ||||| ||| |||||       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  |  || |       |  || | ^*** | |||||| | || |||||^***||||||||     | |      | || | |||||^***|||||||       | ||||| ||| |||||       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  |  || |       |  || | | |  | |||||^***** ||||||  |||||||||     | |      | |^*****||| || |||||||       | ||||| ||| |||||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  ***** |       ***** | | |  *******| | ********************     | |      | |  | ||||| *********|       *****************       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      *******| |       ****| | | |  ******|| | ********************     | |      | |  ****||| **********       ********* ******        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |           | | | |     |  || |                          ***      ***    |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           *** | |     |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^** |  |||||||| |        |  |   | || ||||||||   ||||||||| ||||||||                   | | ||||||  |  || ||       | ||||| |||||||||||     
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                   |  |||||||| |        |  |   ^*** ||||||||   ||||||||^***||||||                   | | |||||^***  || ||       | ||||| |||||||||||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                   |  |||||||| |        |  |   | |  |||||||^*****||||||| ||||||||                   ^*****|||      || ||       | ||||| |||||||||||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   *********** |        |  |   | |  ******|    ******************                     | |||||      || ||       *******************     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   *********** |        ****   | |  ******|    *****************                      ****|||      ****|       ******************      
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***               | |     |  |                                             ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                              ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..    | |||      ^** |  |||||||| ||  | |  || |   | || |  || ||   |||||||||||||| ||||                  ||| ||||||  |  || ||       || |||  ||||||| |||     
search RasMol script viewer Motif-ligand binding stats  PS00006 ..    | |||          |  |||||||| ||  | |  || |   ^*** |  || ||   ||||||||^***|| ||||                  ||| |||||^***  || ||       || |||  ||||||| |||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..    | |||          |  |||||||| ||  | |  || |   | |  |  || |^*****|||||||||||| ||||                  ^*****|||      || ||       || |||  ||||||| |||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |||          |  ******** ||  | ***** |   | |  ***** |    ******************|                   || |||||      || ||       *******************     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    *****          |  |||||||| ||  | |  |  |   | |  |  |  |    | || ||||||||| || |                   || |||||      || ||       || |||  | || || ||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|          *********** |**** *******   | |  ****  |    *******************                   *****|||      ****|       ******************      
search RasMol script viewer Motif-ligand binding stats  nest ..      ***                    ***               | |     |  |                                          |  ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                                          |   ****       ****                               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                               | |                                                   ******                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  ||  | ||  |   |  || | | ||  ||  | |   ||||||||| |||  ||  || |  | |      | || | |||||| || ||||||         |  || ||| ||||| | |   
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  ||  | ||  |   |  || | ^***  ||  | |   ||||||||^***|  ||  || |  | |      | || | |||||^*** ||||||         |  || ||| ||||| | |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  ||  | ||  |   |  || | | ||  ||  | ^*****||||||| |||  ||  || |  | |      | |^*****|||| |  ||||||         |  || ||| ||||| | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  ||  | ||  |   ***** | | |*****  |     |******************** |  | |      | |  | |||||| ********|         *************** | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |****   ****| | | |********     ********************| |  | |      | |  ****|||| ******* |         ******* ******  | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |           | | | |                                 ***  ***      ***    |||||| |    |  |                      |  ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           *** | |                                                      ****|| |    |  |                      |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |                                                       ****| |    ****                      ****     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                           ***                                       

Assembly 1  model: 17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..     |  |      ^**    |||||||| |        |  |   | || |||||||| ||||||| ||| ||||||||  |         | |    ||||||||||  |  || ||            |  ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..     |  |             |||||||| |        |  |   ^*** |||||||| ||||||| ||^***||||||  |         | |    |||||||||^***  || ||            |  ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  PS00008 ..     |  |             |||||||| |        |  |   | || |||||||^*****||| ||| ||||||||  |         | |    ^*****|||      || ||            |  ||| ||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |             ******** |        |  |   | |*********| |******************|  |         | |    ******|||      || ||            ************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****             ******** |        ****   | |*********| |***************** ****         | |    ******|||      ****|            **** ********      
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***               | |     |  |***                  |  |         ***        ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                               | |     ****                     ****                     ****       ****                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                                                                                     

Assembly 1  model: 18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..    | |        ^**    |||||||| |       |  || | |  || |||||||  |||||| |||  |||  || ||                | | ||||||  |  || ||       |  |||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..    | |               |||||||| |       |  || | ^***| |||||||  |||||| ||^***||  || ||                | | |||||^***  || ||       |  |||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..    | |               |||||||| |       |  || |     | ||||||^*****||| |||  |||  || ||                ^*****|||   |  || ||       |  |||  |||||||||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |               ******** |       ***** |     *****|||   |*********************                  | |||||   ***** ||       *****************       
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |               ******** |       ****| |     *******|   ******** **** *******                   ****|||   *******|       **** ***********        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***                      | |           | |         |  |                                             |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           ***         |  |                                             ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ****                                              ****       ****                               

Assembly 1  model: 19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               ^**    |  ||  |||     | || || | |  | ||||||||   ||||||| | ||||||||| |    | |         ||||||||||  |  || ||       | ||||| ||||||||||   | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                      |  ||  |||     | || || | ^*** ||||||||   ||||||| ^***||||||| |    | |         |||||||||^***  || ||       | ||||| ||||||||||   | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                      |  ||  |||     | || || |    | |||||||^*****||||| | ||||||||| |    | |         ^*****|||      || ||       | ||||| ||||||||||   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      |  |*****|     | ***** |    *********    ******* **********| |    | |          ||||||||      || ||       ******************   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ******** |     ******| |    ********|    *********************    | |          |****|||      ****|       ******************   | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             | |           | |         |  |                     |  |    ***          | ||||||       |  |                            | |
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***           ***         |  |                     |  |                 *******|       |  |                            ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ****                     ****                     ****       ****                               

Assembly 1  model: 20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GAG POLYPROTEIN
sec str:  ..eeeee...eeeee..hhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhh....hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..      | |      ^**    |  |  || |       |  || | |  | | |||||| | || || |||  | |  || || |              | ||||||||  |  || ||       |  |||  |||||||||||     
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      | |             |  |  || |       |  || | ^*** | |||||| | || || ||^*** |  || || |              | |||||||^***  || ||       |  |||  |||||||||||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      | |             |  |  || |       |  || |      | |||||^***** || |||  | |  || || |              ^*****|||      || ||       |  |||  |||||||||||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |             |  ***** |       ***** |      *******| | ********|  | ******** |              *****||||      || ||       *******************     
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |             *******| |       ****| |      ******|| | ******* **** *******| |              ******|||      ****|       **** *************      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |                    | |           | |         |  || |                     ***                  |||||       |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..      ***                    ***           ***         |  |***                                          ****|       |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                                       ****                                              ****       ****                               

   New search    1gwp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML