triangle PDBeMotif: 1gim  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.4.4
Classification ligase    | release date: Sat, Jun 15, 1996
Title crystal structure of adenylosuccinate synthetase from escher complexed with gdp, imp, hadacidin, no3-, and mg2+. data co 100k (ph 6.5)
Authors B.W.POLAND, H.J.FROMM, R.B.HONZATKO
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search IMP IMP binding statistics IMP   search HDA HDA binding statistics HDA   search GDP GDP binding statistics GDP   search NO3 NO3 binding statistics NO3
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADENYLOSUCCINATE SYNTHETASE
member of: CATH:search1.10.300.10/search3.40.440.10/search3.90.170.10GENE3D:searchG3DSA_1.10.300.10/searchG3DSA_3.40.440.10/searchG3DSA_3.90.170.10HAMAP:searchMF_00011PANTHER:searchPTHR11846PFAM:searchPF00709PROSITE PATTERNS:searchPS00513/searchPS01266, SMART:searchSM00788SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00184UniProt:searchP0A7D4
JMol viewer RasMol script viewer  GDP 432A  ..            * ***                      ***                                                                                                                                                                                                                                                                      *                         * *                                                                                * **              
JMol viewer RasMol script viewer  IMP 440A  ..          * * |||                    **|||                                                                                    ***             *                                                                                *   *         **                                 **                            * |                         | |                                                                                | ||              
JMol viewer RasMol script viewer  HDA 438A  ..          | * |||                    *|*||                                                                                    ||*             |                                                                                |   |         ||                                 *|                       **** * *                         | |                                                                                | ||              
JMol viewer RasMol script viewer  NO3 433A  ..          |** |*|                    |***|                                                                                    |||             |                                                                               **   |         ||                                 ||                       |||| | |                         | |                                                                                | ||              
JMol viewer RasMol script viewer  MG 435A  ..          ||| |||                    ||*||                                                                                    |||             |                                                                               ||   |         ||                                 ||                       |||| | |                         | |                                                                                | ||              
sec str:  ...eeeeee........hhhhhhhhhhh.eeeee......eeeeeee..eeeeee...hhhh....eeeee......hhhhhhhhhhhhh...hhhhheee........hhhhhhhhhhhhh............hhhhhhhhhh.....hhhhh.hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhheee.hhhhhhhhhh...eeeeee......................hhhhhhhh........eeeeeeee.eee............hhhhhhhhh............eee...hhhhhhhhhhh..eeeeee.hhhh.eeeeeeeeeeeee....ee.............eeeeeeeeee..............hhhhhhhhhhhhhh....eee.........eee......
sequence :  ..GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRDPFDA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |  |||||  |  || ||       ||  |||   |  |    | |  |  | ^***  |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||     | | || |  ||        ^***|||  || ||| ||    |    || |     |  |  | | || || |||  | | || ||   ||||||||   | |     || | || |      ||    | |        |  ||     |     | |||| | || ||   |  ||  ||  |||      || |        | |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |  |||||  |  || ||       ||  |||   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||     | | || |  ||        | | |||  || ||| ||    |    || |     |  |  | | || || |||  | | |**^*   ||||||||   | |     || | || |      ||    | |        |  ||     |     | |||| | || ||   |  ||  ||  |||      || |        | |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  |||||  |  |^**|       ||  |||   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |^**|||| |||||||||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||     | | || |  ||        | | |||  || ||| ||    |    |^**     |  |  | | || || |||  | ^**|      ||||||||   | |     || | || |      ||    | |        |  ||     |     | |||| | || ||   |  ||  ||  |||      || |        | |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  |||||  |  ||  |       ||  |||   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| ^***|  |  || |      | |     | ||| || || | |  |  |  ||||||||||     | | ^***  ||        | | |||  || ||| ||    |    |        |  |  | | || || |||  | | ||      ||||||||   | |     ^*** || |      ||    | |        |  ||     |     | |||| | || ||   |  ||  ||  |||      ^***        | |||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       | |  |||||  |  ||  |       ||  |||   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| ||||*******^ |      | |     | ||| || || | |  |  |  ||||||||||     | | || |  ||        | | |||  || ||| ||    |    |        |  |  | | || || |||  | | ||      ||||||||   | |      | | || |      ||    | |        |  |******^     | |||| | || ||   |  ||  ||  |||       | |        | |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ^*****||||  |  ||  |       ^*****|   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || ||||^*****|||||||^***** ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||     ^***** |  ||        | | ^*****| ||| ||    ^*****        |  |  | | || || ^***** | ||      ||||||||   | |      | | || |      ||    | |        |  |            | |||| | || ^*****  ||  ||  |||       | |        | |||
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||       | |  |  ||        | |  ||  || ||| ||                  |  |  | | || || |||    ^***      ||||||||   | |      | | || |      ||    | |        |  |            | |||| | || ||   |  ||  ||  |||       | |        | |||
search RasMol script viewer Motif-ligand binding stats  RGD ..         |  |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  |||||||***       | |  |  ||        | |  ||  || ||| ||                  |  |  | | || || |||    | |       ||||||||   | |      | | || |      ||    | |        |  |            | |||| | || ||   |  ||  ||  |||       | |        | |||
search RasMol script viewer Motif-ligand binding stats  ADENYLOSUCCIN_SYN_2 ..         |  |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || ||||********^***||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||       | |  |  ||        | |  ||  || ||| ||                  |  |  | | || || |||    | |       ||||||||   | |      | | || |      ||    | |        |  |            | |||| | || ||   |  ||  ||  |||       | |        | |||
search RasMol script viewer Motif-ligand binding stats  ADENYLOSUCCIN_SYN_1 ..         ********  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  ||   |  || |  || |||||||| |||||||||   || ||| |||||  |  || |      | |     | ||| || || | |  |  |  ||||||||||       | |  |  ||        | |  ||  || ||| ||                  |  |  | | || || |||    | |       ||||||||   | |      | | || |      ||    | |        |  |            | |||| | || ||   |  ||  ||  |||       | |        | |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| *****  |  |    *****   ***** |  || |||||||*******||||   || ||*******  ***** |      | |     ***** || || | |  |  **********|||       | |  *****        | |  ||  || ||| ||                  |  |  | | || || |||    | |       ||******   | |      | | || |      ||    | |        |  |            | |||| | || ||   *****  |*****|       | |        | |||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  |    |  |  |  || |||||||| || | ||||   || |***** |   |  |  |      | |     | ||  || || | |  |  |  | || | |||       | |  *****        | |  ||  || ||| ||                  |  |  *****| || |||    | |       *****||    | |      | | || |      ||    | |        |  |            | |||| | || ||   |  |   ||  | |       | |        *****
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  |    |  |  |  || |||||||| || | ||||   || ||| || |   |  |  |      | |     | ||  || || | |  |  |  | || | |||       | |  |  |         | |  ||  || ||| ||                  |  |    |  | || |||    | |       ***||||    | |      | | || |      ||    ***        |  |            | |||| | || ||   |  |   ||  | |       | |        ***| 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |||||  |  ||  |        |  | |   |  |    | |  |  |  |    |  |       |  |  || ||| || ||  |  |    |  |    |  |  |  || |||||||| || | ||||   || ||| || |   |  |  |      | |     | ||  || || | |  |  |  | || | |||       | |  |  |         | |  ||  || ||| ||                  |  |    |  | || |||    | |        ||||||    | |      | | || |      **    | |        |  |            | |||| | || ||   |  |   ||  | |       | |        |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||  ********        |  | |   ****    | |  |  |  |    |  |       ****  |****| ****|  ****    ****    *******  || |||||||****** ||||   ****|******   *******      | |     ****  |****** |  |  ************|       | |  ****         | ********| |*****                  |  |    **********|    | |        ******    | |      | | ****            | |        ****            | ||**** *****   ****   |**** |       | |        **** 
search RasMol script viewer Motif-ligand binding stats  nest ..            *****  |   |  |        |  | |           | |  |  |  |    |  |             |  ***  |  |  |  |                  |  |*********       ****    |  |                      ***       |   |       |  |            ***       | |  |            | |   |   *** |  |                  |  |         |  ***    ***                  ***      *** || |            ***                        | |||| |  |  |          |   ***       | |             
search RasMol script viewer Motif-ligand binding stats  niche ..            |      |   ****        **** |           ***  *******    ****             |    |  ****  ****                  ****                 ***    ****                                |   |       ****                      | ****            ***   |   |   ****                  ****         |    |                                    ******                                       ********  ****          |   |         ***             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |      |   |                |                                            ******                                                                                              |   |                                 |                       |   |                                      ******                                                                                                         |   |                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..            |      *****                |                                                                                                                                                *****                                 |                       *****                                                                                                                                                     *****                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..            *                           *                                                                                                                                                                                      *                                                                                                                                                                                                               

   New search    1gim:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors