triangle PDBeMotif: 1gec  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.22.25
Classification hydrolase/hydrolase inhibitor    | release date: Thu, May 25, 1995
Title glycyl endopeptidase-complex with benzyloxycarbonyl-leucine- glycine-methylene covalently bound to cysteine 25
Authors A.M.HEMMINGS, B.P.OHARA, D.J.BUTTLE, L.H.PEARL
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search PHQ PHQ binding statistics PHQ
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain E sequence:
LPESVDWRAKGAVTPVKHQGYCESCWAFSTVATVEGINKIKTGNLVELSEQELVDCDLQSYGCNRGYQSTSLQYVAQNGI
HLRAKYPYIAKQQTCRANQVGGPKVKTNGVGRVQSNNEGSLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHA
VTAVGYGKSGGKGYILIKNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIKN
Chain I sequence:
LVGX
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : GLYCYL ENDOPEPTIDASE
member of: CATH:search3.90.70.10GENE3D:searchG3DSA_3.90.70.10PANTHER:searchPTHR12411/searchPTHR12411_SF305PFAM:searchPF00112PRINTS:searchPAPAINPROSITE PATTERNS:searchPS00139/searchPS00639/searchPS00640, SMART:searchSM00645SUPERFAMILY:searchSSF54001UniProt:searchP05994
JMol viewer RasMol script viewer  PHQ 1I  ..                                                                                                                                                            *                                                           
sec str:  ..........................hhhhhhhhhhhhhhhhhh.......hhhhhhh...........hhhhhhhhhhh..................hhhh........eeee.....hhhhhhhhhh..eeeee....hhhh................eeeeeeeeeee..eeeeeee...........eeeee........hhh.....eeee..
sequence :  ..LPESVDWRAKGAVTPVKHQGYCESCWAFSTVATVEGINKIKTGNLVELSEQELVDCDLQSYGCNRGYQSTSLQYVAQNGIHLRAKYPYIAKQQTCRANQVGGPKVKTNGVGRVQSNNEGSLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKSGGKGYILIKNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIKN
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     ||| ||||     |     ||  ||           | |    |  | |  |  | |    |   |                 | |  | |           ||    || ||| |  |          |  |  |  |  |    |  | |||    || |      |    |  |  || |    |**^*|    | | |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     ||| ||||     |     ||  ||           | |    |  | |  |  | |    |   |                 | |  ^**           ||    || ||| |  |          |  |  |  |  |    |  | |||    || |      |    |  |  || |    |    |    | | |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ||| ||||     |     ||  ||           | |    ^*** |  |  | |    |   |                 | |                ||    |^***| |  |          |  |  |  |  |    |  ^***|    || |      |    |  |  || |    |    |    | | |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     ||| ||||     |     ||  ||           | |         |  |  | ^*****   |                 | |                ||    |  | ^*****          |  |  |  |  ^*****    | |    || |      |    |  |  || |    |    ^***** ^*****      
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_CYS ..     ||| ||||     ******^*****           | |         |  |  |      |   |                 | |                ||    |  |   |             |  |  |  |            | |    || |      |    |  |  || |    |           | |         
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_HIS ..     ||| ||||     |     ||  ||           | |         |  |  |      |   |                 | |                ||    |  |   |             |  |  |  |            **^********      |    |  |  || |    |           | |         
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_ASN ..     ||| ||||     |     ||  ||           | |         |  |  |      |   |                 | |                ||    |  |   |             |  |  |  |              |    ||        *****^**************           | |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     ||| ||||     |     ||  ||           | |         |  |  |      |   |                 | |                ||    |  *****             |  |  |  |              |    ||             |  |  || |                | |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..     *** ||||     |     ||  ||           | |         |  |  |      |   |                 | |                ||    |  |                 |  |  |  |              |    ||             |  |  || |                | |         
search RasMol script viewer Motif-ligand binding stats  betabulge ..      || ||||     |     ||  ||           | |         |  |  |      |   |                 | |                **    |  |                 |  |  |  |              |    **             |  |  || |                | |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |****||     |     ||  ||           | |         |  |  |      |   |                 | |                      |  |                 |  |  |  |              |                   |  |  || |                | |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  ||||     |     ||  ||           | |         |  |  |      |   |                 | |                      |  |                 |  |  |  |              |                   |  |  |***                | |         
search RasMol script viewer Motif-ligand binding stats  nest ..      |  ****     |     ||  ||           ***         |  |  |      |   |                 ***                      |  |                 |  |  |  |              |                   |  |  |                   ***         
search RasMol script viewer Motif-ligand binding stats  niche ..      |    |      |     ||  ||                       *******      |   |                                          ****                 ****  ****              |                   |  ****                               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..      ******      |     ||  ||                                    |   |                                                                                       |                   |                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  |     ******                                    *****                                                                                       |                   |                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  *     *                                                                                                                                     *                   *                                     

chain I : BENZYLOXYCARBONYL-LEUCINE-VALINE-GLYCINE-METHYLENINHIBITOR;
JMol viewer RasMol script viewer  PHQ 1I  ..**  
sec str:  ......
sequence :  ..LVGX
seq num:  ..2   

   New search    1gec:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML