triangle PDBeMotif: 1gci  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.21.62
Classification serine protease    | release date: Wed, Sep 2, 1998
Title the 0.78 angstroms structure of a serine protease-bacillus l subtilisin
Authors P.KUHN, R.BOTT
Method X-RAY DIFFRACTION (resolution: 0.78Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search GOL GOL binding statistics GOL   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVL
GVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSIS
YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI
RNHLKNTATSLGSTNLYGSGLVNAEAATR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUBTILISIN
member of: CATH:search3.40.50.200GENE3D:searchG3DSA_3.40.50.200PANTHER:searchPTHR10795PFAM:searchPF00082PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SUPERFAMILY:searchSSF52743UniProt:searchP29600
JMol viewer RasMol script viewer  GOL 301A  ..                                                *                                                             *                                                                                                                                                              
JMol viewer RasMol script viewer  CA 278A  ..                                                |                                                             |                                                   *    *                    * *                                                                              
JMol viewer RasMol script viewer  CA 277A  .. *                                     *        |                       * * * *                               |                                                   |    |                    | |                                                                              
JMol viewer RasMol script viewer  SO4 276A  .. |                                     |        |                       | | | |                      *        |                  ***                              |    |                    | |                                                                              
sec str:  .......hhhhh..hhhhhhh.......eeeeee..........eeeeee.............hhhhhhhhhh...............eeeeee.........hhhhhhhhhhhhh....eeee........hhhhhhhhhhhhh..eeeee.................eeeeeee...............eeeeee...eeeee...eeeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.......hhhh......hhhh..
sequence :  ..AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
seq num:  ..1         11        21        31        42        52        63        73        83        93        103       113       123       133       143       153       167       177       187       197       207       217       227       237       247       257       267      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  |||| |  ||||||||| |   |    || ||      | |  | |  |||||||  ||| |||^***   | |  |        | | ||| |||||| ||||||||   ^*** | |  |  |  |  || | |      ||| ||    |  |  |        | | |  |  |  |              |    | ^***  ||  || ||| ||||  || |  | |||||| | || |    |  |||  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |||| |  ||||||||| |   |    || ||      | |  | |  |||||||  ||| ||| |     | |  |        | | ||| |||||| ||||||||   |    | |  |  |  |  |^** |      ||| ||    |  |  |        | | |  |  |  |              |    |  | |  ||  || ||| ||||  || |  | |||||| | || |    |  |||  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |||| |  ||||||||| |   |    ^***|      | |  | ^***||||||  ||| ||| |     | |  |        | | ||| |||||| ||||||||   |    | |  |  |  |  |  | |      ||| ||    |  |  |        | | |  |  |  |              |    |  | |  ||  || ||| ||||  || |  | |||||| | || |    |  |||  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |||| |  ||^*****| |   |     |  |      | |  | |   ^*****  |^***** |     ^*****        ^*****| |||||^*****||^*****    | |  |  |  |  |  | |      ^*****    |  |  |        | | |  |  |  |              ^*****  ^*****|  || ||| ||||  || |  | |||||| | || |    ^*****  | 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..      |  |||| |  || |||| | ****^******  |      | |  | |    |||||  ||| ||  |       |  |          | | | |||||| ||| || |        | |  |  |  |  |  | |       || |     |  |  |        | | |  |  |  |                      | |   |  || ||| ||||  || |  | |||||| | || |       |||  | 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..      |  |||| |  || |||| |     |     |  |      | |  | |    ||^**********  |       |  |          | | | |||||| ||| || |        | |  |  |  |  |  | |       || |     |  |  |        | | |  |  |  |                      | |   |  || ||| ||||  || |  | |||||| | || |       |||  | 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..      |  |||| |  || |||| |     |     |  |      | |  | |    |||||  ||| |   |       |  |          | | | |||||| ||| || |        | |  |  |  |  |  | |       || |     |  |  |        | | |  |  |  |                      **^******** ||| ||||  || |  | |||||| | || |       |||  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *****|| |  || |||| |     |     |  |      | |  | |    |||||  ||| |   |       |  |          | | | ********** || |        | |  |  |  |  |  | |       || |     |  |  |        | | |  |  |  |                        |   |  **********|  || |  *****||| | || |       |||  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |||| |  || |||| |     |     |  |      | |  | |    ***||  ||| |   |       |  |          | | | |||||| ||  || |        | |  |  |  |  |  | |       || |     |  |  |        | | |  |  |  |                        |   |  |  ||| || |  || |  | |||||| | || |       ***  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|*******| ||****     |     ****      | |  | |    ||||********   |       |  |          | | | ************| |        | |  ****  ****  | |       || |     |  |  |        | | |  |  ****                        |   **************  || |  ******** | || |        |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..          ***     ****** |     |     |  |      | |  | |    ****     |     |       |  |          *** |   |         ***        | |              ***       |***     |  |  |        *** |  |  |  |                        |                |  || |    | | || | || |        |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..                      ****     |     ****      ***  ***      |      |     |       ****              |   |                    ***                        || |     *******            ****  ****                        |                ****| |    | **** | || |        |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |                             |      |     |                         *****                    | |                        || |                                                          |                    | |    |   |  | || |        |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               |                             |      |     |                                                  | |                        || |                                                          |                    | |    *****  | || |        ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                               |                             |      |     |                                                  ***                        |***                                                          |                    ***           ******              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                               *                             *      *     *                                                                             *                                                             *                                                      

   New search    1gci:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML