triangle PDBeMotif: 1fx8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification membrane protein    | release date: Mon, Sep 25, 2000
Title crystal structure of the e. coli glycerol facilitator (glpf) substrate glycerol
Authors A.LIBSON, C.WEITZMAN, D.FU, L.J.W.MIERCKE, P.NOLLERT, R.M.STROUD
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search BOG BOG binding statistics BOG   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFAC
FDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILM
GLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GLYCEROL UPTAKE FACILITATOR PROTEIN
member of: CATH:search1.20.1080.10GENE3D:searchG3DSA_1.20.1080.10PANTHER:searchPTHR19139/searchPTHR19139_SF100PFAM:searchPF00230PRINTS:searchMINTRINSICPPROSITE PATTERNS:searchPS00221, SUPERFAMILY:searchSSF81338TIGRFAMS:searchTIGR00861UniProt:searchP0AER0
JMol viewer RasMol script viewer  GOL 663A  ..                                              *             ***                                                                                                                      *               *                                                        
JMol viewer RasMol script viewer  GOL 661A  ..                                              |             |||                                                                     ****                                             |       **  *   |                                                        
JMol viewer RasMol script viewer  GOL 662A  ..                                          *   |             |||                                                                     ||||                                             |       ||  *** |  *                                                     
JMol viewer RasMol script viewer  BOG 475A  ..                                          |   |             |||                                    **                               ||||                                             |       ||  ||| |  |      *                                              
JMol viewer RasMol script viewer  BOG 474A  ..                                          |   |             |||                                    ||                               ||||                                             |       ||  ||| |  | *    |       *           *   *                      
JMol viewer RasMol script viewer  BOG 473A  ..                                          |   |             |||                             *      *|  *   *         *              ||||                                             |       ||  ||| |  | |    *  ***  |           |   |                      
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..TLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAIVGAFAYRKLIGRHL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**|    |   |        |    |  |||   |       |    ||   | ||| ||||     |    | |      |   |   |    |    |    |       | || ||  || | ||   | | |||   |   |   |    | | ||||  |            |    |   |      |||| | |         |||||  || |            |  ||   |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |    |   |        |    |  |||   |       |    ||   | ||| ||||     |    | |      |   |   |    |    |    |       | || ||  || | ||   | | |||   |   |   |    | | ||||  |            |    |   |      |||| | |         |||||  || |            |  ||   |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ^*****   |        ^*****  |^*****       ^*****|   | ^*****||     |    | |      |   |   ^*****    ^*****       | || ^***** | ^***** | |||   |   |   |    ^*****||  |            ^*****   |      |||| | |         |||||  || |            |  ^*****           
search RasMol script viewer Motif-ligand binding stats  MIP ..        |   |                | |                 |   |  || |*********    | |      |   |                          | ||  |  |  |  |     | |||   |   |   |      | | ||  |                 |   |      |||| | |         |||||  || |            |  ||               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |   |                | |                 |   ***** ||||          | |      |   |                          | ||  |  |  |  |     | |||   |   |   |      | | ||  |                 |   |      |||| | |         ||||***** |            *****               
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        |   |                | |                 |   |  || ||||          | |      |   |                          | ||  |  |  |  |     | ||*****   |   |      | | ||  |                 |   |      |||*****         |||||  || |            |  |                
search RasMol script viewer Motif-ligand binding stats  asxturn ..        |   |                | |                 |   |  || ||||          | |      |   |                          | ||  |  |  |  |     ***|        |   |      | | ||  |                 |   |      |||***           |||||  || |            |  |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |   |                | |                 |   ****| ||||          | |      |   |                          | ||  ****  ****     |  |        |   |      | | ||  |                 |   |      ||||             ||||****| |            ****                
search RasMol script viewer Motif-ligand binding stats  nest ..        |   |                ***                 |   |   ******          ***      |   |                          ***|  |              |  |        |   |      | | ||  |                 |   |      ****             ****    ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..        |   |                                    |   |   | |                      |   |                             ****              ****        |   |      | *******                 |   |                               | |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..        *****                                    *****   | |                      *****                                                           *****      *****                     *****                               | |                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                         ***                                                                                                                                                               ***                                

   New search    1fx8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML