triangle PDBeMotif: 1f7l  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.8.7
Classification transferase    | release date: Tue, Jun 27, 2000
Title holo-(acyl carrier protein) synthase in complex with coenzym 1.5a
Authors A.TAM, C.C.FRITZ, J., J.HIXON, K.D.PARRIS, L.LIN, M.STAHL, R.MATHEW, W.S.SOMERS
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search COA COA binding statistics COA   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIR
KDQNGKPYIICTKLSPAAVHVSITHTKEYAAAQVVIERLSS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HOLO-(ACYL CARRIER PROTEIN) SYNTHASE
member of: CATH:search3.90.470.20GENE3D:searchG3DSA_3.90.470.20HAMAP:searchMF_00101PANTHER:searchPTHR11712/searchPTHR11712_SF213PFAM:searchPF01648PRODOM:searchPD004282SUPERFAMILY:searchSSF56214TIGRFAMS:searchTIGR00516/searchTIGR00556UniProt:searchP96618
JMol viewer RasMol script viewer  COA 133A  ..                                                    *                              ****               ***             
JMol viewer RasMol script viewer  CA 132A  ..                                                    |                              ||||               |||  *          
JMol viewer RasMol script viewer  CL 131A  ..         **  *                                      |                              ||||               |||  |          
JMol viewer RasMol script viewer  CA 130A  ..       * ||  |                                      |    *                         ||||               |||  |          
sec str:  ...eeeeeeeeeehhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh........hhhhheeee.....eeeee...eeeeeeeeeee...eeeeeeeee.
sequence :  ..GIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSPAAVHVSITHTKEYAAAQVVIER
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |    |       |  |    |  ||| ||  || |^**                 | |||| || ||||||    | |||    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || |    |       |  |    |  |^***|  || |                    | |||| || |^***|    | |||    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  || |    |       |  |    |  ||*******^ |                    | |||| || ||||||    | |||    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  || ^*****       |  |    |  ||   |  |  |                    | |^***** ||||||    | |||    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  ||              |  |    |  ||   |  |  |                    | |||| |  ||||||    *****    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ||              |  |    |  ||   |  |  |                    | |||| |  ||||||    ***||    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..  **              |  |    |  ||   |  |  |                    | |||| |  ||||||    | |||    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                  |  |    |  ||   |  |  |                    | |||| |  ||||||    *****    |  || |        | ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  |  |    |  ||   |  |  |                    | |||| |  |****|    ****|    ****| |        | ||         
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  |    |  ||   |  |  |                    | **** |  |||| |      ***        | |        | ||         
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****    ****|   |  ****                    |      ****|****                 ***        ****         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              *****                          |          *****                            | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                             |          ***                              ***          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                             *                                                        

   New search    1f7l:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML