triangle PDBeMotif: 1f6a  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification immune system    | release date: Tue, Jun 20, 2000
Title structure of the human ige-fc bound to its high affinity rec fc(epsilon)ri(alpha)
Authors B.A.WURZBURG, J.P.KINET, S.C.GARMAN, S.S.TARCHEVSKAYA, T.S.JARDE
Method X-RAY DIFFRACTION (resolution: 3.50Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search FUC FUC binding statistics FUC   search CPS CPS binding statistics CPS   search MAN MAN binding statistics MAN   search SO4 SO4 binding statistics SO4
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVAESEPVY
LEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHAISITNAAAEDSGTYYCTGKVWQLDY
ESEPLNITVIKAPREK
Chains B,D sequence:
ADPCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPV
GTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQL
PDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPSUBUNIT;
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR11481/searchPTHR11481_SF12PFAM:searchPF13895PROSITE PROFILES:searchPS50835, SMART:searchSM00408/searchSM00409SUPERFAMILY:searchSSF48726UniProt:searchP12319
JMol viewer RasMol script viewer  CPS 103D  ..                                                                                                                                                           *                 
JMol viewer RasMol script viewer  CPS 371A  ..                                                                                                                   *                                       |                 
JMol viewer RasMol script viewer  CPS 370A  ..                                                                                                              * *  |                                       |                 
JMol viewer RasMol script viewer  SO4 205D  ..                                                                                                              | |  |                                       |                 
JMol viewer RasMol script viewer  SO4 203A  ..                                                                                                              | |  |                      **               |                 
JMol viewer RasMol script viewer  SO4 201B  ..                                                                                                              | |  |             *        ||               |                 
JMol viewer RasMol script viewer  NAG 694B  ..                                                                                                              | |  |             |        ||               |                 
JMol viewer RasMol script viewer  FUC 369A  ..                                                                                                              | |  |             |        ||               |                 
JMol viewer RasMol script viewer  NAG 366A  ..                                                                                                              | |  |             |        ||               |         *       
JMol viewer RasMol script viewer  MAN 246A  ..                                                                                                              | |  |             |        ||               |         |       
JMol viewer RasMol script viewer  MAN 244A  ..                                                           *                                                  | |  |             |        ||               |         |       
JMol viewer RasMol script viewer  NAG 243A  ..                                                           |* *                                               | |  |             |        ||               |         |       
JMol viewer RasMol script viewer  NAG 242A  ..                                         *                 |* **                                              | |  |             |        ||               |         |       
JMol viewer RasMol script viewer  NAG 221A  ..                    *                    |                 || ||                                              | |  |             |        ||               |         |       
JMol viewer RasMol script viewer  NAG 222A  ..                    |                    |                 || ||                                              | |  |             |        ||               |         |       
sec str:  ........eeee....eee....eeeee...........eeee..ee......eeee...hhhhheeeeee.........eeeeee...eeeee...ee.....eeeeeee.hhh..eeeeeee..eeeeee................eeeeeeeee..eeee...eeeee....
sequence :  ..VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVAESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHAISITNAAAEDSGTYYCTGKVWQLDYESEPLNITVIKAP
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                |  |^***       ||||| |   ^***||| ^***     ||  |  |     | |                                   |  |        |  | |||                 |    | |           ^***    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                |  |           ||||^**     | ||| |        ||  |  |     | |                                   |  |        |  | |||                 |    ^**                   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                |  |           ||||        ^***| |        ||  |  |     | |                                   |  |        |  | |||                 |    |                     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                |  |           ||||          | | |        *******^     | |                                   |  |        *******^                 |    |                     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  |           ||||          | | |         |  |        | |                                   |  |        |  | ||                  ^*****                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  |           ||||          | | |         |  |        | |                                   |  |        |  | **                                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****           ||||          | | |         ****        | |                                   ****        ****                                                
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |           ****          | | |         |  |        | |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                ****                         *****         ****        ***                                                                                                   

chain B : IG EPSILON CHAIN C REGION
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR23266/searchPTHR23266_SF90PFAM:searchPF07654PROSITE PATTERNS:searchPS00290, PROSITE PROFILES:searchPS50835, SMART:searchSM00407SUPERFAMILY:searchSSF48726UniProt:searchP01854
JMol viewer RasMol script viewer  CPS 371A  ..                                                                                                   *                                                                                                                     
JMol viewer RasMol script viewer  SO4 204B  ..                                                                                                   |                                                                 ** *                                                
JMol viewer RasMol script viewer  SO4 202B  ..                                      **                                                        *  |                                                                 || |                                                
JMol viewer RasMol script viewer  SO4 201B  ..      *                               ||                                                        |  |                                                                 || |                                                
JMol viewer RasMol script viewer  MAN 699B  ..      |                               ||                                                        |  |                                                                 || |                                                
JMol viewer RasMol script viewer  MAN 697B  ..      |                               ||                                                        |  |                                                                 || |                                                
JMol viewer RasMol script viewer  MAN 696B  ..      |    *                          ||                                                        |  |                                                                 || |                                                
JMol viewer RasMol script viewer  NAG 695B  ..      |    *                          ||                        *                               |  |                                                                 || |                                                
JMol viewer RasMol script viewer  NAG 694B  ..      |    |                      *   ||                        * * *                           |  |                                                                 || |                                                
JMol viewer RasMol script viewer  MAN 698B  ..      |    |                      |   ||                        | | |                           |  |                                                                 || |                                                
sec str:  ......hhhhh.eeee..hhhhhhh....eeeeeeeee.........eeee...........eeee.....eeeeeeee.hhhhhhh..eeeeee........eeeeee.........eeeeee.........eeeeeeeeeee.....ee.........hhhhhee...ee.....eeeeeeeeeehhhhhhh..ee..ee........ee..ee...
sequence :  ..PCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
seq num:  ..328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    || ||       || ||| | |      |  |  | |  ^***   | |  ^***| |    ^***          |   | | | |   |  |       | |                 |  |  |           | |            || ||         | |    |  | |  |   | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    || ||       || ||| | |      |  |  | |         ^**    ^** |    | |           |   | | | |   |  |       ^**                 |  |  |           | |            || ||         | |    |  | |  |   | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    || ||       ^***|| | |      |  |  | |         | |     ^***    | |           |   | | | |   |  |                           |  |  |           | |            || ||         | |    ^*** ^***   | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    || ||        |  || | |      |  |  | |         | |             | |           ********^ |   |  |                           |  |  |           | |            || ||         | |                | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..    || ||        |  || | |      |  |  | |         | |             | |               | | **^****  |                           |  |  |           | |            || ||         | |                | |**^****     | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || ||        ***** | |      |  |  | |         | |             | |               | |       |  |                           |  |  |           | |            || ||         | |                | |            | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || ||        |  |  | |      |  |  | |         | |             ***               | |       |  |                           |  |  |           | |            || ||         | |                | |            | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..    *****        ****  | |      |  |  | |         | |             | |               | |       ****                           |  |  |           | |            ****|         | |                | |            | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***      |  |  | |         ***             ***               ***       |  |                           |  |  |           | |             |  |         ***                | |            ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                ****  ***         | |                                         ****                           *******           ***             ****                            ***                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                  ***                                                                                                                                                                    

chain D : IG EPSILON CHAIN C REGION
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR23266/searchPTHR23266_SF90PFAM:searchPF07654PROSITE PATTERNS:searchPS00290, PROSITE PROFILES:searchPS50835, SMART:searchSM00407SUPERFAMILY:searchSSF48726UniProt:searchP01854
JMol viewer RasMol script viewer  CPS 105D  ..                                      *                                                        *                                                                                                                        
JMol viewer RasMol script viewer  CPS 103D  ..                                   *  |                                                        *                                                                                                                        
JMol viewer RasMol script viewer  CPS 371A  ..                                   |  |                                                        |                                                                                                                        
JMol viewer RasMol script viewer  CPS 370A  ..                                   |  |                                                        *                                                                                                                        
JMol viewer RasMol script viewer  SO4 205D  ..                                   |  |                                                        |    * *                                                                                                                 
JMol viewer RasMol script viewer  SO4 204B  ..                                   |  |                                                        |    | |                                                             ** *                                                
JMol viewer RasMol script viewer  MAN 696D  ..                                   |  |                                                        |    | |                                                             || |                                                
JMol viewer RasMol script viewer  NAG 695D  ..          *                        |  |                        *                               |    | |                                                             || |                                                
JMol viewer RasMol script viewer  NAG 694D  ..          |                      * |  |                        * * *                           |    | |                                                             || |                                                
JMol viewer RasMol script viewer  MAN 246A  ..          |                      | |  |                        | | |                           |    | |                                                             || |                                                
sec str:  ..........eeeee..hhhhhhh....eeeeeeeee........eeeee...........eeee.....eeeeeeee.hhhhhhh..eeeeee........eeeeee.........eeeeee.........eeeeeeeeeee.....ee.........hhhhhee...ee.....eeeeeeeeeehhhhhhh..eeeeee........eeeeee...
sequence :  ..CDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVN
seq num:  ..329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..               || ||| | |      |  |  | |  ^***   | |  ^***| |    ^***          |   | | | |   |  |       | |                 |  |  |           | |            || ||         | |    |  | |  |   | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               || ||| | |      |  |  | |         ^**    ^** |    | |           |   | | | |   |  |       ^**                 |  |  |           | |            || ||         | |    |  | |  |   | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               ^***|| | |      |  |  | |         | |     ^***    | |           |   | | | |   |  |                           |  |  |           | |            || ||         | |    ^*** ^***   | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                |  || | |      |  |  | |         | |             | |           ********^ |   |  |                           |  |  |           | |            || ||         | |                | || |   |     | |        
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..                |  || | |      |  |  | |         | |             | |               | | **^****  |                           |  |  |           | |            || ||         | |                | |**^****     | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                ***** | |      |  |  | |         | |             | |               | |       |  |                           |  |  |           | |            || ||         | |                | |            | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |  | |      |  |  | |         | |             ***               | |       |  |                           |  |  |           | |            || ||         | |                | |            | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****  | |      |  |  | |         | |             | |               | |       ****                           |  |  |           | |            ****|         | |                | |            | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                      ***      |  |  | |         ***             ***               ***       |  |                           |  |  |           | |             |  |         ***                | |            ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                               ****  ***         | |                                         ****                           *******           ***             ****                            ***                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 ***                                                                                                                                                                    

   New search    1f6a:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML