triangle PDBeMotif: 1f2f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.112
Classification transferase    | release date: Wed, May 24, 2000
Title src sh2 thref1trp mutant
Authors A.M.CUNNINGHAM, E.F.PAI, G.D.GISH, J.NACHMAN, M.S.KIMBER, T.PAWSON
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search PO4 PO4 binding statistics PO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYIWSRTQFSSL
QQLVAYYSKHADGLCHRLTNVCPT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PFAMB:searchPB005637PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP00523
JMol viewer RasMol script viewer  PO4 300A  ..           *                   * ***     *                                                              
sec str:  ......eee...hhhhhhhhhh.......eeeeeee.....eeeeeeee.......eeeeeeeeee...eeee...eee.hhhhhhhhhhhh.........eee..
sequence :  ..MAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYIWSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
seq num:  ..144       154       164       174       184       194       204       214       224       234       244 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |    |**^* ||  | |||  |     | ||| |   |  | | |            | |||   |  |   |   || |||||| ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |    ^**|^**|  | |||  |     | ^** |   |  | | |            | |||   |  |   |   || |||||| ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |    ^***   |  | |||  |     |  |  |   ^*** | |            | |||   |  |   |   || |||||| ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |           |  | |||  |     |  |  |        | |            | |||   |  |   |   || *****| ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |           |  ***||  |     |  |  |        ***            | |||   |  |   |   || |||||| ||          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |           |  |  ||  |     |  |  |                       *****   |  |   |   || |||||| ||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****           |  |  |****     |  |  |                       ****|   |  |   |   || ****|****          
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |           |  |  ||  |     |  |  |                         ***   |  |   |   ||  || |***           
search RasMol script viewer Motif-ligand binding stats  niche ..  ****           ***********     *******                               ****   |   ||  ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                              *****|   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                   *****                

   New search    1f2f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors