triangle PDBeMotif: 1efn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.112
Classification complex (sh3 domain/viral enhancer)    | release date: Sat, Jun 29, 1996
Title hiv-1 nef protein in complex with r96i mutant fyn sh3 domain
Authors C.-H.LEE, J.KURIYAN
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search PBM PBM binding statistics PBM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
ALFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDS
Chains B,D sequence:
ACAWLEAQEEEEVGFPVRPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGV
RYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FYN TYROSINE KINASE
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR24418/searchPTHR24418_SF44PFAM:searchPF00018PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP06241
sec str:  ...eeee..................eeeeee.....eeeeee....eeeeeehhheee.
sequence :  ..ALFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV
seq num:  ..85        95        105       115       125       135    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            |  |   |  |     ^***|||    | |  |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            ^***   |  |       ^***|    | ^***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..            ****   ****         ***    | |        ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                       ***               

chain B : HIV-1 NEF PROTEIN
member of: CATH:search3.30.62.10GENE3D:searchG3DSA_3.30.62.10/searchG3DSA_4.10.890.10PFAM:searchPF00469PFAMB:searchPB019340SUPERFAMILY:searchSSF55671UniProt:searchP03406
JMol viewer RasMol script viewer  PBM 720D  ..                                         *         *                          ..                          
JMol viewer RasMol script viewer  PBM 710B  ..                                         |         |                          ..              *           
sec str:  ............hhhhhhhhhhhhh..........hhhhhhhhhhhhhhh........................eeeee......eeeee.hhhh...hhhhh.hhh.
sequence :  ..RPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKLVPV..REVLEWRFDSRLAFHHVARELHPEYF
seq num:  ..71        81        91        101       111       121       131       141     ..178       188       198   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | | |          |||| |  | |            | || || |         | |  |       ..        | || || |  || |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ^** |          |||| |  ^**            | || || |         | |  |       ..        | || || |  || |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |   |          ^*****                 | || || |         | |  |       ..        | || || |  || |  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |   |           ||| |                 | || || |         | |  |       ..        | ***** ***** |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |   |           ||| |                 | || || |         | |  |       ..        ******| ****  ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |   |           ||| |                 | |******         | |  |       ..           |  |           
search RasMol script viewer Motif-ligand binding stats  nest ..         |   |           ||| |                 ***               | |  |       ..           |  |           
search RasMol script viewer Motif-ligand binding stats  niche ..         |   |           *****                                   ******       ..           ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..         *****                                                                ..                          

chain C : FYN TYROSINE KINASE
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR24418/searchPTHR24418_SF44PFAM:searchPF00018PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP06241
sec str:  ...eeee..................eeeeee.....eeeeee.....eeeeehhheee.
sequence :  ..ALFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV
seq num:  ..85        95        105       115       125       135    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | |  |   |  |    |^***|||    | ||||    || ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | ^***   |  |    || ^***|    | ^***    || ||   
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | |  |   |  |    **   | |    | ||||    || ||   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          | |  |   |  |         | |    ******    || ||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |  |   ****         | |    | ||||    ****|   
search RasMol script viewer Motif-ligand binding stats  nest ..          | |  |   |  |         | |    | |***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..          ******   ****         ***    | | |      ****   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                       *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                       ***               

chain D : HIV-1 NEF PROTEIN
member of: CATH:search3.30.62.10GENE3D:searchG3DSA_3.30.62.10/searchG3DSA_4.10.890.10PFAM:searchPF00469PFAMB:searchPB019340SUPERFAMILY:searchSSF55671UniProt:searchP03406
JMol viewer RasMol script viewer  PBM 720D  ..                                     *                                        ..                          
sec str:  ............hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh........................eeeee......eeeee.hhhh...hhhhh.....
sequence :  ..RPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKLVPV..REVLEWRFDSRLAFHHVARELHPEYF
seq num:  ..71        81        91        101       111       121       131       141     ..178       188       198   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | |         | ||||| |  | | |          | || || |         | |  |       ..          || || |  ||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ^**         | ||||| |  ^** |          | || || |         | |  |       ..          || || |  ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     | |^*****  |   |          | || || |         | |  |       ..          || || |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | ||||| |  |   |          | || || |         | |  |       ..          ***** *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ****||| |  |   |          | || || |         | |  |       ..          ****| ****      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ||||| |  |   |          | |******         | |  |       ..           |  |           
search RasMol script viewer Motif-ligand binding stats  nest ..                       ****| |  |   |          ***               | |  |       ..           |  |           
search RasMol script viewer Motif-ligand binding stats  niche ..                         *****  |   |                            ******       ..           ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                *****                                         ..                          

   New search    1efn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors