triangle PDBeMotif: 1doc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification oxidoreductase    | release date: Tue, Sep 6, 1994
Title the mobil flavin of 4-oh benzoate hydroxylase: motion of a p group regulates catalysis
Authors B.A.PALFEY, B.ENTSCH, D.L.GATTI, D.P.BALLOU, M., M.S.LAH, V.MASSEY
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search BR BR binding statistics BR   search PHB PHB binding statistics PHB   search FAD FAD binding statistics FAD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFA
GQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDG
FHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFW
TELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREG
RGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : P-HYDROXYBENZOATE HYDROXYLASE
member of: CATH:search3.30.9.10/search3.50.50.60GENE3D:searchG3DSA_3.30.9.10/searchG3DSA_3.50.50.60PANTHER:searchPTHR13789/searchPTHR13789_SF192PFAM:searchPF01494PRINTS:searchRNGMNOXGNASESUPERFAMILY:searchSSF51905/searchSSF54373TIGRFAMS:searchTIGR02360UniProt:searchP20586
JMol viewer RasMol script viewer  PHB 396A  ..                                           * **                                                                                                                                         *             * *        * * *       *                                                                      ** *                                                                                                  
JMol viewer RasMol script viewer  FAD 395A  ..       ** ***                 ***        * ****                                                      *                                                       ***  *                     |             | |        | | |       |                                                              **      ******                                                                                              
JMol viewer RasMol script viewer  BR 519A  ..       || |||                 |||        | ||||                                                      |                                                       |||  |                     |             | |        | | |       |                                                              ||      || |*|||                                  *                                                   **      
JMol viewer RasMol script viewer  BR 398A  ..       || |||                 |||        | ||||                                                      |                                                       |||  |                     |             | |        | | |       |                                                              ||    * ****||                                  |                                                   ||      
JMol viewer RasMol script viewer  BR 397A  ..       || |||                 |||        |***||                                                     ***                                                      |||  |                     |             | |        | | *       |                                                              ||    | || |||||                                  |                                                   ||      
sec str:  ......eeee...hhhhhhhhhhhh....eeee....hhhhh......eeehhhhhhhhh....hhhhhh.eee.eeeeee..eeeeeehhhhh....eee..hhhhhhhhhhhhhhh..eeee..eeeeee.......eeeeee..eeeeee..eeee......hhhh.......eeeeeee..eeeeeee.........eee......eeeeeee..eeeeeeee..........hhhhhhhhhhh..hhhh.......eeeeeee.eeeeeee..ee..eee.....ee.......hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh.hhhhhhhhhhh.........
sequence :  ..MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |    |       | |||        |  || ||  |||         | |||    |  |    |    |        |**^* |                     | |  |  |      | ||            |      |     |  || | |||| |||     |              | |  |  |  |    | || ||   |   | ||||  |         |  |    |  |                       | |    |  |   | ||||    |               | |                          |  |        | |   |  | | ||   | |  |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |    |       | |||        |  || ||  |||         | |||    |  |    |    |        |   | |                     | |  |  |      | ||            |      |     |  || | |||| |||     |              | |  |  |  |    ^**| ||   |   | ^**|  |         |  |    |  |                       | |    |  |   | ||||    |               | |                          |  |        ^**   |  | | ||   | |  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |    |       | |||        |  || ||  |||         | |||    |  |    |    |        |   | |                     | |  |  |      | ||            |      |     |  || | |||| |||     |              | |  |  |  |       | ||   |   |  | |  |         |  |    |  |                       | |    |  |   | ||||    |               | |                          |  |              ^*** | ||   | ^***           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |    |       | |||        |  || ||  |||         | |||    |  |    |    |        |   | |                     | |  |  |      | ||            *******^     |  || | |||| ||******^              | |  |  |  |       | ||   |   |  | |  |         |  |    |  |                       | |    |  |   | ||||    |               | |                          |  |                   | ||   |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****       | |||        |  || ||  |||         | |||    |  |    ^*****        |   | |                     | |  |  |      | ||                         |  || | |||| ||                     | |  |  |  |       | ||   |   |  | |  |         |  |    |  |                       | |    |  |   | |||^*****               | |                          |  |                   | ^*****                
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ****|        |  ****|  |||         ****|    |  |                  |   | |                     | |  |  |      ****                         |  || | ||****|                     | |  |  ****       | ||   |   |  | |  |         |  |    |  |                       | |    |  |   ****||                    | |                          |  |                   |  |   |                
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***        |   |  |  |||           ***    |  |                  |   ***                     ***  |  |      ***                          |  || | || |  |                     | |  |             | ||   |   |  | |  |         |  |    |  |                       | |    |  |     ****                    ***                          |  |                   |  |   |                
search RasMol script viewer Motif-ligand binding stats  niche ..                                  |   ****  ***                  ****                  |   |                            ****                                   ****| **** ****                     | |  |             ****   |   **** ****         ****    ****                       ***    ****                                                          ****                   ****   |                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  *****      |                                         |   |                                                                       |   |                           | |  |             | |    |                                                                                                                                                       *****                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                             |                                         *****                                                                       *****                           | |  |             | |    |                                                                                                                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             |                                                                                                                                                     ***  |             ***    |                                                                                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                             *                                                                                                                                                          *                    *                                                                                                                                                                            

   New search    1doc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML