triangle PDBeMotif: 1d8c  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.1.3.2
Classification lyase    | release date: Fri, Oct 22, 1999
Title malate synthase g complexed with magnesium and glyoxylate
Authors B.R.HOWARD, J.A.ENDRIZZI, S.J.REMINGTON
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search SOR SOR binding statistics SOR   search GLV GLV binding statistics GLV   search SO4 SO4 binding statistics SO4
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAQTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAA
YKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDP
QRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRHYT
AADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEGILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVA
FANKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQANI
AQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQ
HIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MALATE SYNTHASE G
member of: CATH:search1.10.1860.10/search1.20.1220.12/search2.170.170.11/search3.20.20.360GENE3D:searchG3DSA_1.10.1860.10/searchG3DSA_1.20.1220.12/searchG3DSA_2.170.170.11/searchG3DSA_3.20.20.360HAMAP:searchMF_00641PANTHER:searchPTHR21631/searchPTHR21631_SF7PFAM:searchPF01274SUPERFAMILY:searchSSF51645TIGRFAMS:searchTIGR01345UniProt:searchP37330
JMol viewer RasMol script viewer  GLV 2000A  ..                                                                                                                                                                                                                                                                                                         ..GLV ..                           *                                                                                      * *                        ****                                                                                                                                                                                 *                                                                                         
JMol viewer RasMol script viewer  SO4 9000A  ..                                                                                                                                                                                                                                                                                                         ..SO4 ..                           |                                                                                      | |                        ||||                                                                                                                                                                                 |                                                                                 *  *    
JMol viewer RasMol script viewer  SO4 8000A  ..                                                                                                                                                                                                                                              *                  *                                       ..SO4 ..      *                    |                                                                                      | |                        ||||                                                                                                                                                                                 |                                                                                 |  |    
JMol viewer RasMol script viewer  SO4 7000A  ..                                                                                                                                                                                                                                              |                  |                                       ..SO4 ..      |                    |                                                                                      | |                        ||||                                                                                                                                    **                                           |                                                                                 |  |    
JMol viewer RasMol script viewer  SO4 6000A  ..                                                                                                                                                                                                                                              |                  |                                       ..SO4 ..      |                    |                                                                                      | |                        ||||                                           *                                                             *                          ||                                           |                                                                                 |  |    
JMol viewer RasMol script viewer  SO4 5000A  ..                                                                                                                                                                                                                                              |    **         *  |                                       ..SO4 ..      |                    |                                                                                      | |                        ||||                                           |                                                             |                          ||                                           |                                                                                 |  |    
JMol viewer RasMol script viewer  MG 3001A  ..                                                                                                                                                                                                                                              |    ||         |  |                                       ..MG ..      |                    |                                                                                      | *                        |||*                                           |                                                             |                          ||                                           |                                                                                 |  |    
JMol viewer RasMol script viewer  SOR 4000A  ..                                                          *                                                                                                                                                                                   |    ||         |  |                                       ..SOR ..      |                    |                                                                                      | |                        ||||      *                                    |                                                             |                          ||                                           |                                                                   *****         |  |    
sec str:  ...eeee..eeeehhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.................hhhhhh....eeeee..hhhhhhhhhh..eeehhhhhhh..............hhhhhhhhhhhhhhhhhhhh.....hhh.eeeeeee..eeeeee....ee...hhh.eeeee.......eeeeee..eeeeeee.....hhhhh...eeeeeee...eeeee........hhhhhhhhhhhhhhhhh....... ........eeeee....eeee....eeeee......eeeeee.....eeehhhhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhhhhh....eeeeeehhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee.....hhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee.....ee..hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..QTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIELQIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQ... ..RKLNDDRHYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEGILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTPWIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREKES
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293    ... ..311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    || |  |   |          ||||  ||                              |   |      | |   |    ||||          || ||  |  |       |  |   |  | || | |  | |  | || | ||  || | ||  ||      |  ||    ^*** ||     |  |    | |||  | ||| ||   | | |||      |  |      | ||  |  | |||||        |  | |  |   |   |        || |||| ..PS00001..|       ||| ||||  |   |    |  |         | |||    |    |       |  |||||| | |                 |   |  |  |||| ||||      || || |    |  ||  |      |   |  |  || ||        |  |   |         |  ||||| |        |  |     ||| ||| |||   |         |  ||  || | |  || || |  |     ||  |      |^*** ||                    |||   |  | |||    |  | |        || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    || |  |   |          ||||  ||                              |   |      | |   |    ||||          || ||  |  |       |  |   |  | || | |  | |  | || | ||  || | ||  ||      |  ||      || ||     |  |    | |||  | ||| ||   | | |||      |  |      | ||  |  | |||||        |  | |  |   |   |        || |||| ..PS00004..|       ||| ||||  |   |    |  |         | |||    |    |       |  |||||| | |                 |   |  |  |||| ||||      |**^* |    |  ||  |      |   |  |  || ||        |  |   |         |  ||||| |        |  |     ||| ||| |||   |         |  ||  || | |  || || |  |     ||  |      | ||  ||                    |||   |  | |||    |  | |        || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    || |  |   |          ||||  ||                              |   |      | |   |    ||||          || ||  |  |       |  |   |  | || | |  | |  | || | ||  || | ||  ||      |  ||      || ||     |  |    | |||  ^**|| ||   | | |||      |  |      | ||  |  | |||||        |  | |  |   |   |        || |||| ..PS00005..|       ||| ||||  |   |    |  |         | |||    |    |       |  |||||| | |                 |   |  |  |||| |^**      |  || |    |  ||  |      |   |  |  || ||        |  |   |         |  ||||| |        |  |     ^** ||| |||   |         |  ||  || | |  || || |  |     ||  |      | ||  ||                    |||   |  | |||    |  ^**        || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    || |  |   |          ^***  ||                              |   |      | |   |    ||||          |^***  |  |       |  |   |  | || | ^*** |  | || | ||  ^*** ||  ||      |  ||      ^***|     |  |    | |||     || ||   | | |||      |  |      | ||  |  | |||||        ^*** |  |   |   |        || ||^**..PS00006..|       |^***|||  |   |    |  |         | |||    |    |       |  |||||| | |                 |   ^***  |||| |||       |  || |    |  ||  |      |   ^***  ^***|        |  |   |         |  ||||| |        |  |      |  ||| |||   |         |  ||  || | |  || || |  |     ||  |      | |^***|                    |||   |  | |||    |             || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    || |  |   |          ||||  ||                              |   |      | |   |    ||||          |  |   |  |       |  |   |  | || |      |  | || | ||   | | ||  ||      |  ||       |  |     |  |    | |||     || ||   | | |||      |  |      | ||  |  | |||||           | |  |   |   |        || |||| ..PS00007..********^ | ||||  |   |    |  |         | |||    |    |       |  |||||| | |                 |   |     |||| |||       |  || |    |  ||  |      |   |      |  |        |  |   |         |  ||||| |        |  |      |  ||| |||   |         |  ||  || | |  || || |  |     ||  |      | ||   |                    |||   |  | |||    |             || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    || |  |   |          |^*****|                              |   |      | |   |    ||||          |  |   |  |       |  |   |  | || |      |  | || | ^***** | ||  ||      |  ||       |  |     |  |    | |||     || ||   | | |||      |  |      | ||  |  | |||||           | |  |   |   |        ^*****| ..PS00008..          | |^*****   |    |  |         | |||    ^*****       |  |||||| | |                 |   |     |^*****|       |  || |    |  ||  |      |   |      |  |        |  |   |         ^*****|| |        |  |      |  ||| |^*****         |  ||  || | |  || || |  |     ||  |      | ||   |                    |^*****  | |||    |             || ||||                   |  | |||| |^*****  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  RGD ..    || |  |   |          | ||   |                              |   |      | |   |    ||||          |  |   |  |       |  |   |  | || |      |  | || |  |     | ||  ||      |  ||       |  |     |  |    | |||     || ||   *** |||      |  |      | ||  |  | |||||           | |  |   |   |        || |||| ..PS00016..          | ||||      |    |  |         | |||                 |  |||||| | |                 |   |     | || |||       |  || |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  || | |  || || |  |     ||  |      | ||   |                    | |      | |||    |             || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  PTS_HPR_SER ..    || |  |   |          | ||   |                              |   |      | |   |    ||||          |  |   |  |       |  |   |  | || |      |  | || |  |     | ||  ||      |  ||       |  |     |  |    | |||     || ||     | |||      |  |      | ||  |  | |||||           | |  |   |   |        || |||| ..PS00589..          | |||*******^********         | |||                 |  |||||| | |                 |   |     | || |||       |  || |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  || | |  || || |  |     ||  |      | ||   |                    | |      | |||    |             || ||||                   |  | |||| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    || |  |   |          | ||   |                              |   |      | |   |    ||||          |  |   |  |       |  |   |  | || |      |  | || |  |     | |*****      *****       |  |     |  |    | |||     || ||     | |||      |  |      | ||  |  | |||||           | |  |   |   |        || |||| ..alphabetamotif..          | |||            |            | |||                 *****|||| | |                 |   |     | || |||       ***** |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  || | |  ***** |  |     ||  |      | ||   |                    | |      | |||    |             || ||||                   |  | |||| ||*****  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    || |  *****          | |*****                              |   |      | |   |    ||||          |  |   |  |       |  *****  | || |      |  | || |  |     | ||  |       |  |        |  |     |  |    | |||     || ||     *****      |  |      | ||  |  *****||           | |  |   *****        || |||| ..asxmotif..          | |||            |            | |||                 |  |||||| | |                 |   |     | || |||       |  |  |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  |*****  || || |  |     ||  |      | ||   |                    | |      *****    |             || ||||                   |  *****| |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    || |                 | |                                   |   |      ***   |    ||||          |  |   |  |       |  |      | || |      |  | || |  |     ***|  |       |  |        |  |     |  |    | ***     || ||     ***|       |  |      ***|  |  ***||||           ***  |                || |||| ..asxturn..          | ***            |            | |||                 |  |||||| | |                 |   |     | || |||       |  |  |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  |***    || || |  |     ||  |      | ||   |                    | |      ***||    |             || ||||                   |  ***| | |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..    || |                 | |                                   |   |        |   |    ||||          |  |   |  |       |  |      | || |      |  | || |  |        |  |       |  |        |  |     |  |    | |||     || ||     |  |       |  |      |  |  |  | |||**           | |  |                || |||| ..betabulge..          | |||            |            | |||                 |  |||||| | |                 |   |     | || |||       |  |  |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  |       || || |  |     ||  |      | ||   |                    | |      | |||    |             || ||||                   |  |  | | |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    || |                 | |                                   |   |        |   |    ||||          |  |   |  |       |  |      | || |      |  | || |  |        |  |       |  |        |  |     |  |    *****     || ||     |  |       |  |      |  |  |  | |||             | |  |                || |||| ..betabulgeloop..          *****            |            *****                 |  |||||| | |                 |   |     | || |||       |  |  |    |  ||  |      |   |      |  |        |  |   |            ||||| |        |  |      |  ||| |||             |  ||  |       || || |  |     ||  |      | ||   |                    | |      *****    |             || ||||                   |  |  | | |||| ||  |   |     |  ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****                 | |                                   |   |        |   |    ||||          |  |   |  |       |  |      **** |      **** || |  |        ****       ****        |  |     ****    ****|     ****|     ****       ****      |  |  *******|             | |  |                |****|| ..betaturn..          ****|            |            ****|                 ****||||| | |                 |   |     | |****|       *******    ****|  |      |   |      ****        |  |   |            ||||| |        ****      ****|****|             ****|  |       ****| ****     |****      | ||   |                    | |      ****|    |             |****||                   |  **** | ||****|  |   |     |  |****          **** 
search RasMol script viewer Motif-ligand binding stats  nest ..     | |                 ***                                   |   |        |   |    ****          |  |   |  |       |  |        |  |      |  | || |  |                               |  |               ***      |  |                          |  |  |  | ***             | |  |                |  **** ..nest..            ***            |              ***                     ****| ***                 |   |     ***  ***                      |  |      |   |                  |  |   |            *******                      |  ***                 |  |        |  |          ||  |      | ||   |                    ***        ***    |             |  ****                   |  |  | | |***  |  |   |     |  |                   
search RasMol script viewer Motif-ligand binding stats  niche ..     ***                                                       |   |        |   |     ***          ****   ****       ****        ****      ******* ****                               ****                        ****                          ****  ****                 | ****                |   *** ..niche..                           |                                          | |                   |   |          ***                      ****      |   |                  ****   |             ***                         |    |                 ****        ****          |****      ***|   |                                      |             |    |                    ******* ***  ****  |   |     ****                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                               |   |        |   |                                                             | |                                                                                                                          | |                   ******  ..schellmannloop..                           |                                          | |                   |   |                                             |   |                     |   |                                         ******                                           |   |         |   |                                      |             ******                                       |   |                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                               |   |        |   |                                                             | |                                                                                                                          | |                           ..stmotif..                           |                                          | |                   |   |                                             |   |                     *****                                                                                          |   |         *****                                      |                                                          |   |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                               *****        *****                                                             | |                                                                                                                          | |                           ..ststaple..                           |                                          | |                   *****                                             *****                                                                                                                    *****                                                    |                                                          *****                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                              ***                                                                                                                          | |                           ..stturn..                           |                                          ***                                                                                                                                                                                                                                                       |                                                                                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                           * *                           ..REP00000..                           *                                                                                                                                                                                                                                                                                                    *                                                                                           

   New search    1d8c:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors