triangle PDBeMotif: 1d3c  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.4.1.19
Classification transferase    | release date: Wed, Sep 29, 1999
Title michaelis complex of bacillus circulans strain 251 cyclodextrin glycosyltransferase with gamma-cyclodextrin
Authors B.A.VAN DER VEEN, B.W.DIJKSTRA, J.C.M.UITDEHAAG, K.H.KALK, L.DIJKHUIZEN
Method X-RAY DIFFRACTION (resolution: 1.78Å)
PDBe Citation   
Small molecules:    search MPD MPD binding statistics MPD   search GLC GLC binding statistics GLC   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPV
ENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDN
GTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQK
SFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQ
VTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKC
NPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNF
TLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGN
YNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDV
SVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYCLODEXTRIN GLYCOSYLTRANSFERASE
member of: CATH:search2.60.40.10/search2.60.40.1180/search3.20.20.80GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_2.60.40.1180/searchG3DSA_3.20.20.80PANTHER:searchPTHR10357PFAM:searchPF00128/searchPF00686/searchPF01833/searchPF02806PRINTS:searchALPHAAMYLASEPROSITE PROFILES:searchPS51166, SMART:searchSM00632/searchSM00642/searchSM01065SUPERFAMILY:searchSSF49452/searchSSF51011/searchSSF51445/searchSSF81296UniProt:searchP43379
JMol viewer RasMol script viewer  MPD 716A  ..                                                                                                                                                                                                                                                                                                                                                                                         *  *                                                                                                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  CA 689A  ..                                                                                                                                                                                                                                                                                                                          *                                                              |  |                                                                                                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  CA 688A  ..                                                                                                                                          *                                                  *        *                                 *                                                                                 |                                                              |  |                                                                                                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  CA 687A  ..                          *     *                 * *                                                                                     |                                                  |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  GLC 715A  ..                          |     |                 | |                                                                                     |                                                  |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        **                                 *                                                     
JMol viewer RasMol script viewer  GLC 714A  ..                          |     |                 | |                                                                                     |                                                  |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||                                 |                                                     
JMol viewer RasMol script viewer  GLC 713A  ..                          |     |                 | |                                                                                     |                                                  |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||                                 |                                                     
JMol viewer RasMol script viewer  GLC 710A  ..                          |     |                 | |                                                                                     |                                             *    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||                                 |                                                     
JMol viewer RasMol script viewer  GLC 709A  ..                          |     |                 | |                                                                                     |                                             *    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||                            *    |                                                     
JMol viewer RasMol script viewer  GLC 708A  ..                          |     |                 | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        |*****                       **    |  *                                                  
JMol viewer RasMol script viewer  GLC 707A  ..                          |     |                 | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||||||            *          ||    |  |                         *    *                   
JMol viewer RasMol script viewer  GLC 706A  ..                          |     |                 | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              *          **   |                   
JMol viewer RasMol script viewer  GLC 700A  ..                          |     |                 | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||||||            *          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 699A  ..                          |     |                 | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 698A  ..                          |     |                 | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                              |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 697A  ..                          |     |             *   | |                                                                                     |                                             |    |        |                                 |                                                                                 |                                                       *      |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 696A  ..                          |     |             |   | |                                            * **                                     |                                             |    |        |                                 |                                                                                 |                                                       *   *  |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 695A  ..                          |     |             |   | |                                            | *|                                     |*                                            |    |      * |                           * *   |                       *                                                         |           **                                          |   |  |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 694A  ..                          |     |             |   | |                                            | ||                                     ||                                            |    |    * | |                           | |* **                       *                                                         |           ||                                          |   |  |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 693A  ..                          |     |             |   | |                                            | ||                                     ||                                          * |    |    | | |                           | || *|                       | *                                                       |           ||                                          |   |  |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 692A  ..                          |     |             |   | |                                            | ||                                     ||                                          * |    |    | | |                           | || ||                       | |                                                       |           ||                                          |   |  |  |                                                                                                                                                                                                                        ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 691A  ..                          |     |             |   | |                                            | ||                                     ||                                          | |    |    | | |                           | || ||                       | |                                                       |           ||                                          |   |  |  |                             **                                 *                                                                                                                                                       ||||||            |          ||    |  |              |          ||   |                   
JMol viewer RasMol script viewer  GLC 690A  ..                          |     |             |   | |                                            | ||                                     ||                                          | |    |    | | |                           | || ||                       | |                                                       |           ||                                          |   |  |  |                             ||**                              **                                                                                                                                                       ||||||            |          ||    |  |              |          ||   |                   
sec str:  ..................eeeehhhhh...hhhhh.hhhh..............hhhhhhhhhhh.........eeee...eee....ee....ee.......eeeeeee.....hhhhhhhhhhhhhhh..eeeeee...eeee.............eee..eeee...................hhhhhhhh....eee....hhhhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhhhhhh....eeee.........hhhhhhhhhhh..ee.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.hhhh.ee...............hhhhhhhhhhhhhh...eeeee.hhhhh......hhhhh........hhhhhhhhhhhhhhhhhhhhhhheeeeeee...eeeeeee...eeeeeeee......eee.........eee............eeehhhh....eee....eeeeeee......eeeeee..ee....eeeeeee.......eeee..eeehhh.eeee...eeeee......eeeeeeee.........eeeeee....eeeeeeeee........eeeeee.hhhhh..hhhhh..............eeeeeeee...eeeeeeeeee..eeee.....eeee......eeeeee...
sequence :  ..APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMNAVKHMPFGWQKSFMAAVNNYKPVFTFGQWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  | ||||^***|     || |   | |  | || ||||||||| | | ||   |     ||||||||| |    | |  | |  ^*** ^***|||||  | || | |||| ||       |  | |      | ^***     | || ||||  |^***  | |^***|||    |||||| | |  | || |   | ^*** |            | | | | |||| |                      | | |  | | | |   ^***||  |           |||||  |        || || || || |  ||||| | ||  || |      ||| |||     | |||| |   |  |  |   | |  |   |    | |||||| ||  ||  ||| |  |       |    |   | | ||   | || | |   |  | ||| | |     |    | ^***|  |         | |           | ||   |   | |||| |   | |  || |||| |  |         |    |   | |||   ||  |        | |    ^***|  |      ||||||| || ||           | |       |  |          | |  |  | ^***                
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  | ^**|||| |     |^**   | |  | || ||||||||| | | ||   |     ||||||||| |    | |  | |     |   |||||||  | || | |||| ||       |  | |      |  |       | || ||||  | ||   | || |||||    |||||| | |  | || |   |  ||  |            | | | | |||| |                      | | |  | | | |     | ||  |           |||||  |        || || || || |  ||||| | ||  || |      ||| ^**     | |||| |   |  |  |   | |  |   |    | |||||| ||  ||  ||| |  |       |    |   | | ||   | || | |   |  | ||| | |     |    |     |  |         | |           | ||   |   | |^** |   | |  || |||| |  |         |    |   | |||   ||  |        ^**        |  |      ||||||| || ||           | |       |  |          | |  |  |    |                
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  | |||| |     |  |   | |  | || ||||||||| | | ||   |     ||||||||| |    | |  | |     |   |||||||  | || | |||^***       |  | |      |  |       | ^***|||  | ||   | || |||||    ||||^*** |  | || |   |  |^***            | | | | |||| |                      | | |  | | | |     | |^***           |||||  |        ^***| || || ^***|||| | ||  || |      ||| ||      | |||| |   ^***  |   | |  |   |    | |||||| ||  |^***|| |  |       |    |   | | ||   | || | |   ^*** ||| | |     |    |     |  |         | |           | ||   |   | | |  |   | |  ^***|^***  |         |    |   | |||   ||  |                   |  |      ^***||| || ||           | |       |  |          | |  |  |    |                
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  | |||| |     |  |   | |  | || ||||||||| | | ||   |     ||||||||| |    | |  | |     |   |||||||  | || | |||| |        |  | |      |  |       |  | ||||  | ||   | || |||||    ||||||   |  | || |   |  |   |            | | | | |||| |                      | | |  | | | |     | |               *******^         |  | || ||     |||| | ||  || |      ||| ||      | |||| |      |  |   | |  |   |    | |||||| ||  |    || |  |       |    |   | | ||   | || | |      | ||| | |     |    |     |  |         | |           | ||   |   | | |  |   | |   |  ||| |  |         |    |   | |||   ||  |                   |  |       || ||| || ||           | |       |  |          | |  |  |    |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  | |||| |     |  |   ^***** || |||^***** | | ||   |     |||||^*****    | |  | |     ^*****|||||  | || | |||| |        |  | |      |  |       |  | ||||  | ^***** || |||||    ^*****   ^*****| |   |  |   |            | | ^*****|| |                      | | |  | | | |     | |                ||||            |  | || ||     |||| | ||  || |      ||| ||      | |||| |      |  |   | |  |   |    | |||||| ||  |    || |  |       ^*****   | | ||   | ^*****      | |^*****     ^*****     |  |         | |           | ^*****   | ^*****   | |   ^***** |  |         ^*****   | |^*****|  |                   |  |       || ||| || ||           | |       |  |          ^*****  ^*****                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  | |||| |     |  |     |  | || ||| ||||  | | ||   |     ||||| |||      | |  | |         |||||||  | || *****| |        |  | |      |  |       |  | ||||  |  |   | || |||||     |||||   |  |  | |   |  |   |            | |   | |||| |                      | | |  | | | |     | |                ||||            |  | || ||     |||| | ||  || |      ||| ||      | |||| |      |  |   | |  |   |    | *****| ||  |    || |  |                | | ||   |  | | |      | ||| |                  |  |         | |           |  |       | | |      | |   |  ||| |  |                  | |||    |  |                   |  |       *****| || ||           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  | |||| |     |  |     |  | || ||| ||||  | | |*****     ||||| |||      | |  | |         |||||||  | || *****| |        |  | |      |  |       |  | ||||  |  |   | || |||||     |||||   |  |  | |   |  *****            | |   | |||| |                      | | |  | | | |     | |                ||||            |  | || ||     |||| | ||  || |      ||| ||      | |||| |      |  |   | |  |   |    | |||| | ||  |    || |  |                | | ||   |  | | |      ***** |                  |  |         | |           |  |       | | |      | |   |  ||| |  |                  | |||    |  |                   |  |       || ||| || ||           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  ****** |     |  |     |  | || ||| ||||  | | |          ***|| |||      | |  | |         |||||||  ***| ***| | |        |  | |      |  |       |  | ||||  |  |   | || |||||     |***|   |  |  | |   |  |                | |   | |||| |                      | | |  | | | |     | |                ||||            |  | || ||     ***| | ||  |***      ||| ||      | |||| |      |  |   | |  |   |    | |||| ***|  |    || |  |                | ***|   |  | | |      ***|| |                  |  |         | |           |  |       | | |      | |   |  ||| |  |                  | |||    |  |                   |  |       || ||| || ||           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |  |  ||  |     |  |     |  | || ||| ||||  | | |          ||||| |||      | |  | |         |||||||  |  | |  | | |        |  | |      |  |       |  | ||||  |  |   | || |||||     |||||   |  |  | |   |  |                | |   | |||| |                      | | |  | | | |     | |                ||||            |  | || ||     |||| | ||  |         ||| ||      | |||| |      |  |   | |  |   |    | |||| |  |  |    ** |  |                | |  |   |  | | |      | ||| |                  |  |         | |           |  |       | | |      | |   |  |** |  |                  | |||    |  |                   |  |       || ||| || ||           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |  |  |  ||  |     |  |     |  | || ||| ||||  | | |          ||||| |||      | |  | |         |||||||  |  | |  | | |        |  | |      |  |       |  | ||||  |  |   | || |||||     |||||   |  |  | |   |  |                | |   | |||| |                      | | |  | | | |     | |                ||||            |  | || ||     |||| | ||  |         ||| ||      | |||| |      |  |   | |  |   |    | |||| |  |  |       |  |                | |  |   |  | | |      | ||| |                  |  |         | |           |  |       | | |      | |   |  |   |  |                  *****    |  |                   |  |       || ||| || ||           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  ****  |****     ****     |  | *********||  | | |          ||||****|      | |  | |         |****||  |  | **** | |        **** |      |  |       |  ******  ****   | || |||||     |||||   |  |  | |   |  |                | |   | |||| |                      | | |  | | | |     | |                ||||            |  | ****|     |||| | |****         ||| ||      ****** |      |  |   | |  |   |    ****** |  |  |       |  |                | |  |   |  | | |      ****| |                  ****         | |           ****       | | |      | |   |  |   |  |                  ****|    |  |                   ****       *****| *****           | |       ****          | |                           
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |  |  ||  |              |  |  |  |  ||||  | | |          ||||  | |      | |  | |         | |||||  |  |      | |           | |      |  |       |  | | |          | |***||||     |||||   |  |  | |   |  |                | |   | |||| |                      | | |  | | | |     | |                ||||            |  |  |  |     |||| | ||  |         ||| ||        | || |      |  |   | |  |   |        |  |  |  |       |  |                | |  |   |  | | |        | | |                  |  |         | |           |  |       | | |      | |   |  |   |  |                    | |    |  |                   |  |          | |  |  |           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  nest .. |  |  |  ||  |              |  |  |  |  ****  | ***          ****  ***      | |  | |         | |****  |  |      | |           ***      |  |       |  | ***          | |   ****     |****   |  |  | |   |  |                ***   | |*** |                      | | |  | | | |     ***                ****            |  |  |  |     |||| | ||  |         ||| ||        ******      |  |   | |  |   |        |  |  |  |       |  |                | |  |   |  | | |        *****                  |  |         | |           |  |       *** |      | |   |  |   |  |                    ***    |  |                   |  |          ***  |  |           | |       |  |          | |                           
search RasMol script viewer Motif-ligand binding stats  niche .. ****  ********              ****  ****   ******                             ***  ***         | |      ****      | |                    ****       ****              ***            | | |   ****  ***   ****                      | | ****                      | | **** | | |     | |                                ****  ****     **** *******         ||****                    ****   ******   |        ****  ****       ****                ******   **** ***                               ****         ***           ****         ***      ***   ****   ****                           ****                   ****               ****           ***       ****          ***                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                              | |                | |                       |                                        | | *****                                     | |                           | |      *****     | |                                                ||                  ||  ||                                *****                                                           | |                                                                                                                                                                                                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              | |                | |                       |                                        | |                                           | |                           | |      | |       | |                                                ||                  ******                                                                                                | |                                                                                                                                                                                                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ***                ***                       |                                        ***                                           | |                           | |      ***       ***                                                ||                                                                                                                        ***                                                                                                                                                                                                                                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                           *                                                                                      * *                           * *                                                                   **                                                                                                                                                                                                                                                                                                                                                                      

   New search    1d3c:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors