triangle PDBeMotif: 1ctp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.37
Classification transferase/transferase inhibitor    | release date: Thu, Apr 8, 1993
Title structure of the mammalian catalytic subunit of camp-depende kinase and an inhibitor peptide displays an open conformati
Authors J.M.SOWADSKI, J.ZHENG, N.H.XUONG, R.KARLSSON, S.S.TAYLOR
Method X-RAY DIFFRACTION (resolution: 2.90Å)
PDBe Citation   
Small molecules:    search MYR MYR binding statistics MYR
Modified residues:  search TPO TPO binding statistics TPO search TYI TYI binding statistics TYI
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain E sequence:
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVV
KLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSL
DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKG
PGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Chain I sequence:
TTYADFIASGRTGRRNAIHD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : CAMP-DEPENDENT PROTEIN KINASE
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24353/searchPTHR24353_SF26PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011/searchPS51285, SMART:searchSM00133/searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP36887
JMol viewer RasMol script viewer  MYR 0E  ..       **                                                                                    *                                                   *  *                                                                                                                                                      *           ..MYR ..            ..          
sec str:  ......hhhhhhhhhhhhhhhhhhhhh...........eeeeeeeee...eeeeeeee.....eeeeeeeehhhhhh...hhhhhhhhhhhhh........eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhh..ee........eee.....eee......ee...........................hhhhhhhhhhhhhhhh.........hhhhhhhhhh..........hhhhhhhhhh................hhhh..hhhhh..hhhhhh............. ..........................
sequence :  ..KKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK... ..FDDYEEEEIRVS..EKCGKEFSEF
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307        ... ..327         ..341       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..**^*|||||||||         |  |      || ||     ||  | |          |    ||      || ||||  |  |  || || |  |     | || ||                       |  |                 | |   | || || || |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | ||||| | |  ||  || || || |   || ||||       ..PS00004.. |       | |..| | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||^**|||         |  |      || ||     ||  | |          |    ||      || ||||  |  |  || || |  |     ^**| ||                       |  |                 | |   | || || || |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     ^**        |  |  | || | ||^** | |  ||  || || || |   || ||||       ..PS00005.. |       | |..| | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ^***^***||         |  |      || ||     ||  | |          |    ||      || ||||  ^***  || || |  |     ^*** ||                       |  |                 | |   | || || || |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  ||  || || || |   || ||||       ..PS00006..**       | ^..* | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||| ||  ||         |  |      || ||     ||  | |          ^*****|      || ||||        || || |  |        | ||                       |  |                 | |   | || || || |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || ^*****|  || || || |   || ||||       ..PS00008..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP .. | ||| ||  ||         |  |      || ||     ************************      || ||||        || || |  |        | ||                       |  |                 | |   | || || || |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  ||  || || || |   || ||||       ..PS00107..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST .. | ||| ||  ||         |  |      || ||     ||  | |                       || ||||        || || |  |        | ||                       |  |                 | ****^********| |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  ||  || || || |   || ||||       ..PS00108..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ***** |*****         |  |      || ||     ||  | |                       || ||||        ***** |  |        | ||                       |  |                 | |   | || ||  | |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  |***** || || |   || ||||       ..alphabetamotif..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||  ||  |          |  |      || ||     ||  | |                       || ||||        || || |  |        ***|                       |  |                 | |   | || ||  | |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  ||  |  || || |   || ||||       ..asxturn..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  betabulge .. | ||  ||  |          |  |      || ||     **  | |                       || ||||        || || |  |        |  |                       |  |                 | |   | || ||  | |||     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  ||  |  || || |   || ||||       ..betabulge..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. | ||  ||  |          |  |      || ||         | |                       || ||||        || || |  |        |  |                       |  |                 | |   | || ||  *****     |  |      | |   ||  |  |  |||| |  |             | |       |  |     | |        |  |  | || | || || | |  ||  |  || || |   || ||||       ..betabulgeloop..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****  |****          |  |      *****         | |                       |****||        ****| |  |        |  |                       ****                 | |   | ****|  ****|     |  |      | |   ||  |  ****||| ****             | |       ****     | |        ****  **** | ****| | ********  |******   *****||       ..betaturn..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |   |              |  |                    ***                       |  ||||         |  | |  |        |  |                                            | |   | || ||    | |     |  |      | |   ||  |     ||||                  | |                | |                |  | ||  | | |      |  |  |  |      ||||       ..gammaturn..         | |..  | |     
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |              |  |                                              |  ****         |  | |  |        |  |                                            ***   | || ||    ***     |  |      | |   ||  |     ****                  ***                ***                |  | ||  | | |      |  |  |  |      ****       ..nest..         ***..  ***     
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |              ****                                              |    |          **** ****        ****                                                  | |****            ****      ***   |****                                                                 ********** ***      ****  ****                 ..niche..            ..          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   |   |                                                                ******                                                                                 | |  |                             |                                                                                                                    ..schellmannloop..            ..          
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****                                                                                                                                                       | |  |                             |                                                                                                                    ..ststaple..            ..          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                               * *  *                             *                                                                                                                    ..REP00000..            ..          

chain I : CAMP-DEPENDENT PROTEIN KINASE INHIBITOR, ALPHA FO
member of: PANTHER:searchPTHR15416/searchPTHR15416_SF2PFAM:searchPF02827PIRSF:searchPIRSF001667PRODOM:searchPD010366UniProt:searchP61926
sec str:  ...hhhhhhh..........
sequence :  ..TTYADFIASGRTGRRNAI
seq num:  ..5         15      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |   ^**^**|   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***   | ||  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        | |^***   
search RasMol script viewer Motif-ligand binding stats  stturn ..        ***       

   New search    1ctp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors