triangle PDBeMotif: 1cg6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.4.2.28
Classification transferase    | release date: Sat, Mar 27, 1999
Title structure of human 5'-deoxy-5'-methylthioadenosine phosphory complexed with 5'-deoxy-5'-methylthioadenosine and sulfate resolution
Authors M.D.ERION, S.E.EALICK, T.C.APPLEBY
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search MTA MTA binding statistics MTA   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWA
LKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLG
LRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE PHOSPHOR
member of: CATH:search3.40.50.1580GENE3D:searchG3DSA_3.40.50.1580HAMAP:searchMF_01963PANTHER:searchPTHR11904/searchPTHR11904_SF1PFAM:searchPF01048PROSITE PATTERNS:searchPS01240, SUPERFAMILY:searchSSF53167TIGRFAMS:searchTIGR01694UniProt:searchQ13126
JMol viewer RasMol script viewer  MTA 292A  ..                                                                                     ***                                                                                *                 **                      **    ..MTA ..      *                                             
JMol viewer RasMol script viewer  SO4 295A  ..        **                                         **                               **||                                                                                |                 ||*                     ||    ..SO4 ..      |                                             
sec str:  ....eeeeee......hhh....eee............eeeeee..eeeeeee.........hhh..hhhhhhhhhh....eeeeeeeee..........eee..eeeee.............................hhhhhhhhhhhhh.........eeeee.......hhhhhhhhh....eee..hhhhhhhhhh...eeeeeeeeee....... .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....
sequence :  ..AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCW... ..AVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219   ... ..230       240       250       260       270         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|   |    || | |  |  || |   | |||          | |    |   | |||||| ||           | |          |||| ||  |        | || |  | ||||   |         | |          ||| |||     |    | | | ||| |      | |   ^***| |    | |||   |    || |  ..PS00001..  |   |  | ||      ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |    || | |  |  |^**   | |||          | |    |   | |||||| ||           | |          ^**| ||  |        | |^**  | ||||   |         | |          ^** |||     |    | | | ^** |      | |     ||| |    | |||   |    || |  ..PS00005..  |   |  ^**|      ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |    ^*** |  |  |      | |||          | |    |   | |||||| ||           | |          ^*** ||  |        | |     ^***||   |         | |           || |||     |    | | |  ^***      | |     |^***    | |||   |    ^***  ..PS00006..  |   |  ^***      ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*   ^*****| | |  |  |      | |||          | |    |   | |||||| ||           | |           ||  ||  |        | |     | ||^*****         | |           || |||     ^***** | |            | |     | |      | |^*****     | |  ..PS00008..  |   |            ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  PNP_MTAP_2 ..          | | |  |  |      | |||          | |    *****************************************|  ||  |        | |     | || |             | |           || |||            | |            | |     | |      | |||         | |  ..PS01240..  |   |            ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | | |  |  |      | |||          | |        | ||||*****           | |            |  ||  |        | |     | || |             | |           || |||            | |            | |     | |      | |||         | |  ..alphabetamotif..  |   |            ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | | |  |  |      | |||          | |        | |||||| ||           | |            |  ||  |        | |     | || |             | |           || |||            | |            | |     | |      | |||         ***  ..asxturn..  |   |            ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | |  |  |      ****|          | |        ****||****|           | |            |  |****        | |     | || |             | |           |****|            | |            | |     | |      ****|         | |  ..betaturn..  |   |            ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  nest ..          *** |  |  |      | | |          | |          **** |  |           ***            |  ||  |        | |     | |***             | |           |  ***            | |            ***     | |        ***         | |  ..nest..  |   |            ||  ||   |  |           | | ||   
search RasMol script viewer Motif-ligand binding stats  niche ..              *******      | | |          ***           |   ****                          ********        ***     | |                ***           |    |            ***                    ***                    | |  ..niche..  |   |            ||  ||   ****           | ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                           | | |                        |                                                         | |                              ******                                                          | |  ..schellmannloop..  |   |            ||  ||                  |   |    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           *****                        |                                                         | |                                                                                              | |  ..stmotif..  *****            ||  ||                  |   |    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           | |                          |                                                         | |                                                                                              | |  ..ststaple..                   ******                  *****    
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                          |                                                         ***                                                                                              | |  ..stturn..                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                        *                                                                                                                                                          * *  ..REP00000..                                                    

   New search    1cg6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML