triangle PDBeMotif: 1c9u  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.1.99.17
Classification oxidoreductase    | release date: Tue, Aug 3, 1999
Title crystal structure of the soluble quinoprotein glucose dehydr complex with pqq
Authors A.OUBRIE, B.W.DIJKSTRA, H.J.ROZEBOOM
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search PQQ PQQ binding statistics PQQ   search GOL GOL binding statistics GOL   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
DVPLTPSQFAKAKSENFDKKVILSNLNKPHALLWGPDNQIWLTERATGKILRVNPESGSVKTVFQVPEIVNDADGQNGLL
GFAFHPDFKNNPYIYISGTFKNPKSTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKIYYT
IGDQGRNQLAYLFLPNQAQHTPTQQELNGKDYHTYMGKVLRLNLDGSIPKDNPSFNGVVSHIYTLGHRNPQGLAFTPNGK
LLQSEQGPNSDDEINLIVKGGNYGWPNVAGYKDDSGYAYANYSAAANKSIKDLAQNGVKVAAGVPVTKESEWTGKNFVPP
LKTLYTVQDTYNYNDPTCGEMTYICWPTVAPSSAYVYKGGKKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDAVPM
FKSNNRYRDVIASPDGNVLYVLTDTAGNVQKDDGSVTNTLENPGSLIKFTYKAK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SOLUBLE QUINOPROTEIN GLUCOSE DEHYDROGENASE
member of: CATH:search2.120.10.30GENE3D:searchG3DSA_2.120.10.30PANTHER:searchPTHR19328PFAM:searchPF07995PFAMB:searchPB003106SUPERFAMILY:searchSSF50952TIGRFAMS:searchTIGR03606UniProt:searchP13650
JMol viewer RasMol script viewer  GOL 1007A  ..  **                                                                                                    ..                                                                                                                                                                                                                                *         **                               *                                                                        
JMol viewer RasMol script viewer  GOL 1006A  ..  ||                                                                                                    ..                                                                                                                                                                                            *                                   |         ||                               |                                                                        
JMol viewer RasMol script viewer  GOL 1005A  ..  ||                                                                                                    ..                                                          *                                                                                                                                 |                                   |       * |*                               |                                                                        
JMol viewer RasMol script viewer  PQQ 1004A  ..  ||                                                                       *                            ..                                 *                        |                                                          **                * *                                                  |                                   |       * |* * *                         **|                           * *                                          
JMol viewer RasMol script viewer  CA 1003A  ..  ||                                                                       |                            ..                                 |                        |                                                          ||                |*|                                                  |                                   |       | || | |                         |||                           | |                                          
JMol viewer RasMol script viewer  CA 1002A  ..  ||                                                                       |                            ..                                 |                        |                                                          ||                |||    *         *                                   |                                   |       | || | |                         |||                           | |                                          
JMol viewer RasMol script viewer  CA 1001A  ..  ||                                                                       |                            ..                                 |                        |                                                          ||                |||    |         |     * * *                         |         *                         |       | || | |                         |||                           | |                                          
sec str:  ......hhhhhhh.......eeeee.....eeeeee.....eeeee....eeeee......eeeeee.............eeeeee........eeeeeeeee......eeeeeeeeeee....eeeeeeeeeeee.......eeeeee.....eeeee......hhhhh..........hhhhhhh........eeeee...................eeee...eeeeeee.....eeeeee.....eeeeee.....................ee.hhhh....................eehhhhh.........eee..........hhhhh.hhhhhh........ee.............eeeee......eeeee............eee......eeeeee......eeeee.....ee.....ee........eeee.
sequence :  ..DVPLTPSQFAKAKSENFDKKVILSNLNKPHALLWGPDNQIWLTERATGKILRVNPESGSVKTVFQVPEIVNDADGQNGLLGFAFHPDFKNNPYIYISGTFKNPK..PNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKIYYTIGDQGRNQLAYLFLPNQAQHTPTQQELNGKDYHTYMGKVLRLNLDGSIPKDNPSFNGVVSHIYTLGHRNPQGLAFTPNGKLLQSEQGPNSDDEINLIVKGGNYGWPNVAGYKDDSGYAYANYSAAANKSIKDLAQNGVKVAAGVPVTKESEWTGKNFVPPLKTLYTVQDTYNYNDPTCGEMTYICWPTVAPSSAYVYKGGKKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDAVPMFKSNNRYRDVIASPDGNVLYVLTDTAGNVQKDDGSVTNTLENPGSLIKFT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 ..111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            |||||                   | |   | | | |    |  ||| | |  |  |  |  | |             | |     | |   .. ^*** | || ^*** |      || || ||||| | |   | |||   |  | |  || || | ||| |  |  |  | || |||        | | |  |       | | |  |  | |     | |         |  |    | ||||||  |    ||| |   ^***| ^***||||||| | ||||   || ||||| |        | || |     |  |  |  | |          || ||||||| |    | || |  |   | ||||  |       | |         ||||              ||| | |          |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..            |||||                   | |   | | | |    |  ||| | |  |  |  |  | |             | |     | |   ..      **^*    | |      || || ||||| | |   | |||   |  | |  || || | ||| |  |  |  | || |||        | | |  |       | | |  |  | |     | |         |  |    | ||||||  |    ||| |    |  | | ||||||||| | ||||   || ||||| |        | || |     |  |  |  | |          || ||||||| |    | || |  |   | ||||  |       | |         ||||              ||| | |          |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            |||||                   | |   ^** ^**    |  ||^** |  |  |  |  | |             | |     ^**   ..              | |      || || ^**|| ^**   | |||   |  | |  || || | ||| |  |  |  | || |||        | | |  |       | | |  |  | |     | |         |  |    | ||||||  |    ||| |    |  | | ^**|||||| | ||||   || ||^** |        | || |     |  |  |  | |          || ||||||| |    ^**| |  |   | ||||  |       | |         ||||              ||| | |          ^
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            |||||                   | |       | |    |  |||   |  |  |  |  | |             | |           ..              | |      || || ^***| |     | |||   ^*** |  || || | ||| |  ^***  | || |||        | | |  |       | | |  |  | |     | |         ^***    | ||||||  |    ||| |    |  | | ^***||||| | ||||   || || |  |        ^*** |     ^***  |  | |          || |||^*** |       | |  |   | |||^***       | |         ||||              ||| | |           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            |||||                   | |       | |    |  |||   |  |  |  |  | |             | |           ..              | |      || ||  |||| |     | |||      | |  || || | ||| |     |  | || |||        | | |  |       | | |  |  | |     | |                 | ||||||  |    ||| |    |  | |  |  ||||| | ||||   || || |  |          |  |           |  | |          || ||| ||| |       | |  *******^||          | |         ||||              ||| | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |||||                   | |       | |    |  |^*****  |  |  |  | |             | |           ..              | |      || ^*****|| |     | |||      | |  || || | ||| |     |  | || |||        | | |  |       | | |  |  | |     | |                 | ^*****  |    ||| |    |  | |  |  ||||^*****^*****| || |  |          |  |           |  | |          ^***** ||| |       | |      | ||||          | |         ||||              |^*****           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..            |||||                   | |       | |    |  |||      |  |  |  | |             | |           ..              | |      ||  |  | || |     | |||      | |  || || | ||| |     |  | || |||        | | |  |       | | |  |  | |     | |                 |  |||||  |    ||| |    |  | |  |  ||||| | |  |   || || |  |          |  |           |  | |          ^***|  ||| |       | |      | ||||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||                   | |       | |    |  |||      |  |  |  | |             | |           ..              | |      ||  |  | || |     | |||      | |  || || | ||| |     |  | || |||        | | |  |       | | |  |  | |     | |                 |  |||*****    ||| |    |  | |  |  ||||| | |  |   || || |  |          |  |           |  | |           |  |  ||| |       | |      | ||||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            |||||                   | |       | |    *****|      |  |  |  | |             | |           ..              | |      ||  |  | || |     | |||      | |  || || | ||| |     |  | || |||        | | |  |       | | |  |  | |     | |                 |  |||||  |    ||| |    |  | |  |  ||||| | |  |   || || |  |          |  |           |  | |           |  |  ||| |       | |      | ||||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |||||                   ***       | |    |  | |      |  |  |  | |             | |           ..              | |      ||  |  | || |     | |||      | |  || || | *** |     |  | || |||        | | |  |       | | |  |  | |     | |                 |  |***|  |    ||| |    |  | |  |  ||||| | |  |   || || |  |          |  |           |  | |           |  |  ||| |       | |      | ||||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |||||                   | |       | |    |  | |      |  |  |  | |             | |           ..              | |      **  |  | || |     | |||      | |  || || |  |  |     |  | || |||        | | |  |       | | |  |  | |     | |                 |  | | |  |    ||| |    |  | |  |  ||||| | |  |   || || |  |          |  |           |  | |           |  |  ||| |       | |      | ||||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |||||                   | |       | |    ******      |  |  |  | |             | |           ..              | |       |  |  | || |     *****      | |  || || |  |  |     |  | || |||        | | |  |       | | |  |  | |     | |                 |  | | |  |    ||| |    |  | |  |  ||||| | |  |   || || |  |          |  |           |  | |           |  |  ||| |       | |      | ||||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||                   | |       | |       | |      |  |  **** |             | |           ..              | |       |  |  | || |     ****|      | |  ***** |  ****     **** |****|        | | |  |       | | |  |  | |     | |                 **** | |  |    ||| |    |  | |  |  ||||| | |  |   ****| |  |          ****           |  | |           |  |  ||| |       | |      ****||          | |         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |||||                   | |       | |       | |      |  |  |  | |             ***           ..              | |       |  |  | || |       | |      | |     |  |  |  |        | |  ***        | | |  |       | | |  |  | |     | |                 |  | | |  |    ||| |    |  | |  |  ||||| | |  |    |  | |  |          |  |           |  ***           |  |  ||| |       | |        ||||          ***         ||||              | | | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            ****|                   ***       ***       ***      |  |  |  | |                           ..              ***       |  |  | |***       ***      ***     |  |  |  |        ***             *** |  |       | | |  |  | |     ***                 |  | ***  |    *** |    |  | |  |  ******* |  |    |  | |  |          |  |           |  |             |  |  *** |       ***        ****                      ****              | | | |           
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                             | |                ****  ******                           ..                        ****  | |                           ****  ****                            ****       *** ****  ***                         ****   ****     ****    **** ****          ****    **** ****          ****           ****             ****  *****                                                              *** ***           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***                                                       ..                              ***                                                                            ***                                                                                                                                                                                                                      ***           

chain B : SOLUBLE QUINOPROTEIN GLUCOSE DEHYDROGENASE
member of: CATH:search2.120.10.30GENE3D:searchG3DSA_2.120.10.30PANTHER:searchPTHR19328PFAM:searchPF07995PFAMB:searchPB003106SUPERFAMILY:searchSSF50952TIGRFAMS:searchTIGR03606UniProt:searchP13650
JMol viewer RasMol script viewer  GOL 1005B  ..                                                                                                                                                                                                                                                                                                                                                      *                                                                                                             
JMol viewer RasMol script viewer  PQQ 1004B  ..                                                                           *                                                                   *                                                                                   ** *              *                                                                                                *  * * *                         **                            * *                                            
JMol viewer RasMol script viewer  CA 1003B  ..                                                                           |                                                                   |                                                                                   || |              |*                                                                                               |  | | |                         ||                            | |                                            
JMol viewer RasMol script viewer  CA 1002B  ..                                                                           |                                                                   |                                                                                   || |              ||     *                                                                                         |  | | |                         ||                            | |                                            
JMol viewer RasMol script viewer  CA 1001B  ..                                                                           |                                                                   |                                                                                   || |              ||     |                 * *                                   *                                 |  | | |                         ||                            | |                                            
sec str:  ......hhhhhhh.....eeeeeee.....eeeeee.....eeeee....eeeee........eeee.............eeeeee........eeeeeeeee..........eeeeeeeeeee....eeeeeeeeeeee.......eeeeee.....eeeee......hhhhh..........hhhhhhh........eeeee...........ee..ee..eeee...eeeeeee.....eeeeee.....eeeee......................ee.hhhh....................eehhhhh.........eee..............................eee............eeeee......eeeeee......eeeeee........eeeeee.....eeeeee.....ee.....ee........eeeeee.
sequence :  ..DVPLTPSQFAKAKSENFDKKVILSNLNKPHALLWGPDNQIWLTERATGKILRVNPESGSVKTVFQVPEIVNDADGQNGLLGFAFHPDFKNNPYIYISGTFKNPKSTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKIYYTIGDQGRNQLAYLFLPNQAQHTPTQQELNGKDYHTYMGKVLRLNLDGSIPKDNPSFNGVVSHIYTLGHRNPQGLAFTPNGKLLQSEQGPNSDDEINLIVKGGNYGWPNVAGYKDDSGYAYANYSAAANKSIKDLAQNGVKVAAGVPVTKESEWTGKNFVPPLKTLYTVQDTYNYNDPTCGEMTYICWPTVAPSSAYVYKGGKKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDAVPMFKSNNRYRDVIASPDGNVLYVLTDTAGNVQKDDGSVTNTLENPGSLIKFTYK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  ||||||     |  |          | |   | | | |    |  ||| | || |  |  |  | |             | |     | |    | ||| ^*** | || ^*** |      || || | ||| | |     | |   |  | |  |  |  | ||| |  |  || | |   |  |    | ||| |  |       | |||  |  | |     | |         |  |    | ||||||  |    ||| |   ^***| ^***||||||||| ||||   || ||||| |   ||   | || |     || || |  | |          || ||||||| |    | || |  |   | ||||  |   |  |          | ||||            | ||| | |          | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |  ||||||     |  |          | |   | | | |    |  ||| | || |  |  |  | |             | |     | |    | ||| |    **^*    | |      || || | ||| | |     | |   |  | |  |  |  | ||| |  |  || | |   |  |    | ||| |  |       | |||  |  | |     | |         |  |    | ||||||  |    ||| |   ||| | | ||||||||||| ||||   || ||||| |   ||   | || |     || || |  | |          || ||||||| |    | || |  |   | ||||  |   |  |          | ||||            | ||| | |          | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  ||||||     |  |          | |   ^** ^**    |  ||^** || |  |  |  | |             | |     ^**    ^**|| |            | |      || || ^**|| ^**     | |   |  | |  |  |  | ||| |  |  || | |   |  |    | ||| |  |       | |||  |  | |     | |         |  |    | ||||||  |    ||| |   ||| | | ^**|||||||| ||||   || ||^** |   ||   | || |     || || |  | |          || ||||||| |    ^**| |  |   | ||||  |   |  |          | ||||            | ||| | |          ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  ||||||     |  |          | |       | |    |  |||   || |  |  |  | |             | |            ^***| |            | |      || || ^***| |       | |   ^*** |  |  |  | ||| |  ^***| | |   |  |    | ||| |  |       | |||  |  | |     | |         ^***    | ||||||  |    ||| |   ||| | | ^***||||||| ||||   || || |  |   ||   ^*** |     ^***| |  | |          || |||^*** |       | |  |   | |||^***   |  |          | ||||            | ||| | |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |  ||||||     |  |          | |       | |    |  |||   || |  |  |  | |             | |                | |            | |      || ||   | | |       | |      | |  |  |  | ||| |  |   | | |   |  |    | ||| |  |       | |||  |  | |     | |                 | ||||||  |    ||| |   ||| | |  | |||||||| ||||   || || |  |   ||     |  |      |  | |  | |          || ||| ||| |       | |  *******^||      |  |          | ||||            | ||| | |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |  ||||||     |  |          | |       | |    |  |^*****| |  |  |  | |             | |                | |            | |      || ^***** | |       | |      | |  |  |  | ||| |  |   | | |   |  |    | ||| |  |       | |||  |  | |     | |                 | ^*****  |    ||| |   ||| | |  | |||||^*****^*****| || |  |   ||     |  |      |  | |  | |          ^***** ||| |       | |      | ||||      |  |          | ||||            | |^*****             
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        |  ||||||     |  |          | |       | |    |  |||   || |  |  |  | |             | |                | |            | |      ||  |     | |       | |      | |  |  |  | ||| |  |   | | |   |  |    | ||| |  |       | |||  |  | |     | |                 |  |||||  |    ||| |   ||| | |  | |||||||| |  |   || || |  |   ||     |  |      |  | |  | |          ^***|| ||| |       | |      | ||||      |  |          | ||||            | ||| | |             
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        |  ||||||     |  |          | |       | |    *****|   || |  |  |  | |             | |                | |            | |      ||  |     | |       | |      | |  |  |  | ||| |  |   | | |   |  |    | ||| |  |       | |||  |  | |     | |                 |  |||||  |    ||| |   ||| | |  | |||||||| |  |   || || |  |   ||     |  |      |  | |  | |           |  || ||| |       | |      *****|      |  |          | ||||            | ||| | |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..        |  ||||||     |  |          ***       | |    |  | |   || |  |  |  | |             | |                | |            | |      ||  |     | |       | |      | |  |  |  | *** |  |   | | |   |  |    | ||| |  |       | |||  |  | |     | |                 |  |***|  |    ||| |   *** | |  | ***||||| |  |   || || |  |   ||     |  |      |  | |  | |           |  || ||| |       | |      ***|||      |  |          | ||||            | ||| | |             
search RasMol script viewer Motif-ligand binding stats  betabulge ..        |  ||||||     |  |          | |       | |    |  | |   ** |  |  |  | |             | |                | |            | |      **  |     | |       | |      | |  |  |  |  |  |  |   | | |   |  |    | ||| |  |       | |**  |  | |     | |                 |  | | |  |    ||| |    |  | |  |  ||||||| |  |   || || |  |   **     |  |      |  | |  | |           |  || ||| |       | |      | ||||      |  |          | ||||            | ||| | |             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        |  ||||||     |  |          | |       | |    ******      |  |  |  | |             | |                | |            | |       |  |     | |       | |      | |  |  |  |  |  |  |   | | |   |  |    ***** |  |       | | |  |  | |     | |                 |  | | |  |    ||| |    |  | |  |  ||||||| |  |   || || |  |          |  |      |  | |  | |           |  || ||| |       | |      | ||||      |  |          | ||||            ***** | |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|||||     |  |          | |       | |       | |      |  |  **** |             | |                | |            | |       |  |     | |       | |      | **********  ****  |   | | |   |  |    ****| |  |       | | |  |  | |     | |                 **** | |  |    ||| |    **** |  |  ||****| |  |   ****| |  |          |  |      **** |  | |           ********| |       | |      ****||      |  |          ****||            ****| | |             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |||||     |  |          | |       | |       | |      |  |  |  | |             ***                | |            | |       |  |     | |       | |      | |     |  |  |  |  |   | | |   |  |      | | |  |       | | |  |  | |     | |                 |  | | |  |    ||| |    |  | |  |  ||||| | |  |    |  | |  |          |  |           |  ***           |  |  ||| |       | |        ||||      |  |            ||||              | | | |             
search RasMol script viewer Motif-ligand binding stats  nest ..            ****|     |  |          ***       ***       ***      |  |  |  | |                                | |            ***       |  |     ***       ***      ***     |  |  |  |  |   | ***   |  |      *** |  |       | | |  |  | |     ***                 |  | ***  |    *** |    |  | |  |  ******* |  |    |  | |  |          |  |           |  |             |  |  *** |       ***        ****      |  |            ****              *** | |             
search RasMol script viewer Motif-ligand binding stats  niche ..             ****     ****                    | |       | |      ****  ******                                ***                      ****                                ****  ****  |   |       ****          ****       *** ****  ***                         ****   ****     ****    **** ****          ****    *********          ****           ****             ****  *****                            ****                                  ***             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              | |       | |                                                                                                                           *****                                | |                                                                                                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ***       ***                                                                                                                                                                ***                                                                                                                                                                                                                                      

   New search    1c9u:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors