triangle PDBeMotif: 1bwp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.1.47
Classification hydrolase    | release date: Sun, Sep 27, 1998
Title probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase
Authors H.ARAI, J.AOKI, J.LI, J.MASUYAMA, K.INOUE, P.J.SHEFFIELD, U.DEREWENDA, Y.S.HO, Z.DEREWENDA
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSGDENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSAVQLMHQCEIWRELFSPLHALNFGIGGDSTQHV
LWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVR
AALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLTQDQGQGGAPLPEPSPP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
member of: CATH:search3.40.50.1110GENE3D:searchG3DSA_3.40.50.1110PANTHER:searchPTHR11852PFAM:searchPF13472SUPERFAMILY:searchSSF52266UniProt:searchQ29460
sec str:  ....hhh............hhhhhhhhhhhhhhh....eeeee.hhhhhhhh...hhhh.hhh.eeeee.....hhhhhhhhh..........eeeee.........hhhhhhhhhhhhhhhhhh....eeeee..........hhhhhhhhhhhhhhhhhh....eeee.........................hhhhhhhhhhhhhhhhh..
sequence :  ..ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSAVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..* |  |     | ||||||          |  |        |||    |  |        | | | |||||  |       ||||| |         | ||  |      |    |       |  |                                  |  |   | | | || ||| ^***| ||||                     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |     | ||||||          |  |        |||    |  |        | | | ||^*****       ||||| |         | ||  |      ^*****       |  |                                  |  |   | | | || |||  |  | ||||                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     ***|||||          |  |        ***    |  |        | | ***| ||          ||||| |         | ||  |                   |  |                                  |  |   ***** || |||  |  | ***|                     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |       ||||||          |  |         |     |  |        | | | || ||          ||||| |         | ||  |                   |  |                                  |  |   | | | |*****  |  | ||||                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |       ||||||          |  |         |     |  |        | | | || ||          ||||| |         | |****                   |  |                                  |  |   | | | |****|  |  ****||                     
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |       ******          |  |         |     |  |        *** | || ||          ****| |         ***|  |                   |  |                                  |  |   | | ***  ***  |  | ***|                     
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                       ****         |     ****            *******           ******           |****                   ****                                  ****   *** ***       **** |  |                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                          *                          *                             *                                                                                       *  *                     

   New search    1bwp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML