triangle PDBeMotif: 1bte  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.
Classification transferase    | release date: Tue, Sep 1, 1998
Title crystal structure of the extracellular domain of the type ii receptor
Authors J.GREENWALD, S.CHOE, W.FISCHER, W.VALE
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCC
CEGNMCNEKFSYFPEME
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (ACTIVIN RECEPTOR TYPE II)
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PANTHER:searchPTHR23255/searchPTHR23255_SF64PFAM:searchPF01064PRINTS:searchACTIVIN2RSUPERFAMILY:searchSSF57302UniProt:searchP27038
JMol viewer RasMol script viewer  NAG 147A  ..                           ..       * *  * *                                            *     
JMol viewer RasMol script viewer  NAG 124A  ..      *          *  **     ..       | |  | |                                            |     
sec str:  .....eeeee...hhhh....eeeee.......eeeeeeeee..eeeeeeeeee...........eee.......eeeee....hhh.eee.....
sequence :  ..ETQECLFFNANWERDRTNQTGVEPCYG..RRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEME
seq num:  ..7         17        27     ..38        48        58        68        78        88        98   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              | |^*** |  | ..      | |^***|        | |     |  |  |||||         | |||||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              | |  || |  | ..      | | |  |        | |     |  |  |**^*         | |||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              | |  || |  | ..      ^** |  |        | |     |  |  | |           | |||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              | |  ^***  | ..          |  |        | |     |  |  | |           | |||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |   ^***** ..          |  |        | |     |  |  | |           ^*****|        
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |          ..          ****        | |     |  |  | |           ****| |        
search RasMol script viewer Motif-ligand binding stats  nest ..              ***          ..                      | |     |  |  | |             *** |        
search RasMol script viewer Motif-ligand binding stats  niche ..                           ..                      ***     ****  ***              ****        

chain B : PROTEIN (ACTIVIN RECEPTOR TYPE II)
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PANTHER:searchPTHR23255/searchPTHR23255_SF64PFAM:searchPF01064PRINTS:searchACTIVIN2RSUPERFAMILY:searchSSF57302UniProt:searchP27038
JMol viewer RasMol script viewer  NAG 147B  ..                                      * *  *                               *              *   
JMol viewer RasMol script viewer  NAG 124B  ..      *          *  ***               | |  |                               |              |   
sec str:  .....eeeee...hhhh....eeeee.........eeeeeeeee..eeeeeeeeee...........eee.......eeeee....hhh.eee...
sequence :  ..ETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPE
seq num:  ..7         17        27        37        47        57        67        77        87        97  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              | |^*** | |||| ||      | |^***    ||           |  |  |||||         | |||||      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              | |  || | |||| ||      | |        ||           |  |  |**^*         | |||||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              | |  || | |||| ||      ^**        ||           |  |  | |           | |||||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              | |  ^*** |||| ||                 ||           |  |  | |           | |||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |   ^*****|| ||                 ||           |  |  | |           ^*****|      
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |       | |***|                 ||           |  |  | |           | ||| |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |       | ||  |                 **           |  |  | |           | ||| |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |       | ||  |                              |  |  | |           ****| |      
search RasMol script viewer Motif-ligand binding stats  nest ..              ***       ***|  |                              |  |  | |             *** |      
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****                              ****  ***              ****      

   New search    1bte:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML