triangle PDBeMotif: 1bk2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification sh3-domain    | release date: Tue, Jul 14, 1998
Title a-spectrin sh3 domain d48g mutant
Authors J.C.MARTINEZ, L.SERRANO, M.T.PISABARRO
Method X-RAY DIFFRACTION (resolution: 2.01Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : A-SPECTRIN
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR11915/searchPTHR11915_SF250PFAM:searchPF00018/searchPF00435PRINTS:searchSH3DOMAIN/searchSPECTRNALPHAPROSITE PROFILES:searchPS50002, SMART:searchSM00150/searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP07751
sec str:  ....eeee..................eeeeee.....eeeeee..eeeeeehhheeee.
sequence :  ..KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
seq num:  ..6         16        26        36        46        56     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | || | |  |    |^***|||            || ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             ^**| ^**  |    |||^**||            || ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^***   |  |    |||^***|            || ||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  |   |  |    ||| ***|            || ||    
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |   |  |    **| |  |            || ||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |   ****      | |  |            ****|    
search RasMol script viewer Motif-ligand binding stats  niche ..             ****   ****      ******             ****    

   New search    1bk2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML