triangle PDBeMotif: 1ayd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.48
Classification hydrolase(sh2 domain)    | release date: Sun, May 15, 1994
Title crystal structures of peptide complexes of the amino- terminal sh2 domain of the syp tyrosine phosphatase
Authors C.-H.LEE, J.KURIYAN
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYM
EHHGQLKEKNGDVIELKYPLN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN-TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2DOMAIN);
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_3.30.505.10PANTHER:searchPTHR19134/searchPTHR19134_SF64PFAM:searchPF00017PIRSF:searchPIRSF000929PROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP35235
sec str:  ...........hhhhhhhhhhhhh...eeeeee.......eeeeeee..eeeeeeeee....ee........hhhhhhhhhhhhhhh.ee...ee....ee..
sequence :  ..MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN
seq num:  ..3         13        23        33        43        53        63        73        83        93         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  || ^*** |     |  ||  ||       |  |   | |            ||||          |  |        |  |   | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||  ||  |     |  ||  ||       |  |   ^**            ||||          |  |        |  |   | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  ||  |^***     |  ||  ||       |  |                  ||||          ^***        |  |   | |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  ||  |         |  ^*****       |  |                  ||||                      |  |   | |         
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  |         |  |****        |  |                  ||||                      |  |   | |         
search RasMol script viewer Motif-ligand binding stats  nest .. |  ||  |         |  ||  |        |  |                  ****                      |  |   ***         
search RasMol script viewer Motif-ligand binding stats  niche .. ********         ********        ****                  | |                       ****               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                        ***                                          

   New search    1ayd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors