triangle PDBeMotif: 1awx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Mon, Oct 6, 1997
Title sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
Authors C.I.E.SMITH, H.HANSSON, M.VIHINEN, P.ALLARD, P.HAAPANIEMI, P.T.MATTSSON, T.HARD
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRUTON'S TYROSINE KINASE
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR24418/searchPTHR24418_SF92PFAM:searchPF00018PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchQ06187
sec str:  ...........eee...................eee........eeeee.....eeeee..........
sequence :  ..GSMSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDS
seq num:  ..1         11        21        31        41        51        61     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  ^***                 | ||  |         | |    | | |     |  |^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|                 | ||  |         | |    | | |     |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |                 | ||  |         | |    *** |     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****                 | ||  |         | |      | |     |  |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***|  |         | |      | |     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  |         | |      ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                           ****         ***              ****      

   New search    1awx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML