triangle PDBeMotif: 1aut  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.21.69
Classification hydrolase/hydrolase inhibitor    | release date: Sat, Jun 8, 1996
Title human activated protein c
Authors C.ESM, P.HOF, R.HUBER, S.FOUNDLING, T.MATHER, V.OGANESSYAN, W.BODE
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search 0G6 0G6 binding statistics 0G6
Modified residues:  search BHD BHD binding statistics BHD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain C sequence:
LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNY
SKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHN
ECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRD
KEAPQKSWAP
Chain L sequence:
SKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCA
PGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : ACTIVATED PROTEIN C
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24278/searchPTHR24278_SF0PFAM:searchPF00089PIRSF:searchPIRSF001143PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP04070
JMol viewer RasMol script viewer  0G6 1C  ..                                         *                                         **                                                                                  *                *** * *                  *** *                          
sec str:  ................eeeee.....eeeeeeeee..eeee.hhh.......eeee............eeeeeeeeee.............eeeee.................hhhhhh.......eeeeee...................eeeeee...hhhhhhh........eeee................eeeeee..eeeeeeeeee..........eeeeehhh.hhhhhhhh..
sequence :  ..LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRD
seq num:  ..16        26        36        46        56        65        75        85        95        105       115       125       131       141       149       157       167       177       186       195       205       215       225       235       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | ||||  |     ||||        |  | | | ||| || |   |  | |  | |  |     ||   | ^***|| | |            |  |      | |    |  |  |     | |  | ||     ^***            |  || | |  | ||    |  | || |||||||  |  |  |       || || ||   |     |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  ^**|||  |     ^**|        |  | | | ||| |^**   |  | |  | |  |     ||   |  || || | |            |  |      | |    |  |  |     | |  ^**|                     |  || | |  | ||    |  | || |||||||  |  |  |       || || ||   |     |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |    ||||  |      | |        |  | | | ||| ||     |  | |  | |  |     ||   |  || ^*** |            |  |      | |    |  |  |     | |  ^***                     |  || | |  | ||    |  | || |||||||  |  |  |       ^***| ||   |     |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |    ||||  |      | |        |  | | | ||| ||     |  | |  | |  |     ||   |  || || | |            |  |      | |    |  |  |     | |                           |  || | |  | ||    |  | || |||||||  |  |  |       ||  | ^*****     |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  RGD ..|  |    ***|  |      | |        |  | | | ||| ||     |  | |  | |  |     ||   |  || || | |            |  |      | |    |  |  |     | |                           |  || | |  | ||    |  | || |||||||  |  |  |       ||  |  |         |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..|  |     | |  |      | |        |  | ****^*| ||     |  | |  | |  |     ||   |  || || | |            |  |      | |    |  |  |     | |                           |  || | |  | ||    |  | || |||||||  |  |  |       ||  |  |         |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..|  |     | |  |      | |        |  |   | ||| ||     |  | |  | |  |     ||   |  || || | |            |  |      | |    |  |  |     | |                           |  || | |  | ||    |  | |******^*****  |  |       ||  |  |         |  ||  |  || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |     | |  |      | |        |  |   | ||| ||     |  | |  | |  |     ||   |  || || | |            |  |      | |    |  |  |     | |                           ***** | |  | ||    |  | |  |||||||     |  |       ||  |  |         *****  ***** |
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |     | |  |      | |        |  |   | ||| ||     |  | |  | |  |     ||   |  || || | |            |  |      ***    |  |  |     | |                           |  |  | |  | ||    |  | |  |||||||     |  |       ||  |  |         |  |   |  || |
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |     | |  |      | |        |  |   | ||| ||     |  | |  | |  |     **   |  || || | |            |  |             |  |  |     | |                           |  |  | |  | ||    |  | |  |||||||     |  |       **  |  |         |  |   |  || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |     | ****      | |        |  |   *******|     |  | |  | |  |          |  || || | |            ****             *******     | |                           ****  | |  | ||    **** |  *******     ****           |  |         ****   ****| |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |     | |  |      | |        |  |     | |  |     |  | |  | |  |          |  || || | |                             |  |  |     | |                              |  | |  | ||    |  | |  |||||||                    |  |                    ***
search RasMol script viewer Motif-ligand binding stats  nest ..|  |     ***  |      ***        |  |     | |  |     |  | |  | |  |          |  || |*** |                             |  |  |     | |                              |  | |  | ||    |  | |  ||***||                    |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..****       ****                 ****     | ****     **** **** ****          ****| |    |                             *******     ***                              ******  ****    ******  ||*****                    ****                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         |                                      ***    |                                                                                  ***             ||||||                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                         *                                             *                                                                                                  ******                                                

chain L : ACTIVATED PROTEIN C
member of: CATH:search2.10.25.10GENE3D:searchG3DSA_2.10.25.10/searchG3DSA_4.10.740.10PANTHER:searchPTHR24278/searchPTHR24278_SF0PFAM:searchPF00594/searchPF14670PIRSF:searchPIRSF001143PRINTS:searchGLABLOODPROSITE PATTERNS:searchPS00010/searchPS00022/searchPS01186/searchPS01187, PROSITE PROFILES:searchPS50026/searchPS50998, SMART:searchSM00069/searchSM00179/searchSM00181SUPERFAMILY:searchSSF50494/searchSSF57196/searchSSF57630UniProt:searchP04070
sec str:  ....................eeee......eeee....................hhhh...eeee....eeee....eee......eee...........
sequence :  ..QCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWK
seq num:  ..49        59        69        79        89        99        109       119       129       139     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |        || ||||||| |  |  |||||| ||  ||||     ^***|  |           | ||||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |        || ||||||| |  |  |||||| ||  ||||     | |||  |           **^*||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |        || |||||^***  |  |||||^***  ||||     | |||  |             | ||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |        || ||||| | |  ^*****||  |   ||||     | |||  |             | ||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  ASX_HYDROXYL ..| |        || ||||| **^*********|  |   ||||     | |||  |             | ||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  EGF_1 ..| |        || |||||         |^*^********^||     | |||  |             | ||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..| |        || |||||         || ||  |   ||||     | |||  |             | ||  |  | |||||      |  |   
search RasMol script viewer Motif-ligand binding stats  EGF_2 ..| |        || |||||         |^*^********^||     | |||  |             ^*^************^      |  |   
search RasMol script viewer Motif-ligand binding stats  EGF_CA ..^*^********^***^^***********^*  |  |   ||||     | |||  |                |  |  | ||||       |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | |||||             |  |   ||||     ***||  |                |  |  | ||||       |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ******|             ****   ||||     |  |****                ****  ****||       |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..              *****             |  |   ****     |  |                    |  |    ****       |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                ****    ***     ****                    ****               ****   

   New search    1aut:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML