triangle PDBeMotif: 1auk  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.6.8
Classification hydrolase    | release date: Fri, Aug 29, 1997
Title human arylsulfatase a
Authors G.LUKATELA, K.THEIS, K.VON FIGURA, N.KRAUSS, V.GIESELMANN, W.SAEN
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search NAG NAG binding statistics NAG   search NDG NDG binding statistics NDG
Modified residues:  search ASN ASN binding statistics ASN search FGL FGL binding statistics FGL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLGTPSRAALLTGRLPVRMGMYPGVLVPSSRG
GLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVP
IPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAV
GTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLP
TLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS
SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPA
CCHCPDPHA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARYLSULFATASE A
member of: CATH:search3.30.1120.10/search3.40.720.10GENE3D:searchG3DSA_3.30.1120.10/searchG3DSA_3.40.720.10PANTHER:searchPTHR10342/searchPTHR10342_SF22PFAM:searchPF00884/searchPF14707PROSITE PATTERNS:searchPS00149/searchPS00523, SUPERFAMILY:searchSSF53649UniProt:searchP15289
JMol viewer RasMol script viewer  MG 603A  ..          **                                                                                                                                                                                                                                                          **                                                                                                                                                                 ..MG ..                                                        
JMol viewer RasMol script viewer  NAG 602A  ..          ||                                                                                      *                         *                                                                   *                                                                     ||                                                                                                                                                                 ..NAG ..                                                        
JMol viewer RasMol script viewer  NDG 601A  ..          ||                                                                                      |                         *                                        *                   *      |                                                                     ||                                                                                                                                                                 ..NDG ..                                                        
sec str:  .....eeeeeee........hhh.......hhhhhhhh..eee.........hhhhhhhhhh...hhhh.....................hhhhhhhh..eeeeee.......hhh...hhhh...eeeee.................................eee..eeee....hhhhhhhhhhhhhhhhhhhhh....eeeeee....................hhhhhhhhhhhhhhhhhhhhhhh...hhheeeeeee.....hhhhhh...............hhhh....eee.......eee.....hhhhhhhhhhhh..............hhhhh........eeee............eeee..eeee......hhh.....hhh............eeee................ ....hhhhhhhhhhhhhhhhhhhh.......hhh...hhh..................
sequence :  ..RPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLGTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLG... ..ATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCP
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439  ... ..448       458       468       478       488       498   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  | |  |  | |  |           |    |           ||   | |    |||   | | ||||  |  | | || || |||      |||||    | |||  |      |   || |  | ^***    |  |||||  |       ^***                         | |||       | | |     ||| || | |     |  ||    |    | | |||| |||     |    | ||  |  ||||  || | |||  |      | |||    | |  |  |   | |  |||   ^***   | |   |||||| |       |  | | |     ||||       |||||||| ||  |  |  |  |     | |   ||||   |..PS00001..|                  |  |            |  |       | ||  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | |  |  | |  |           |    |           ||   ^**    |||   | | ^**|  |  | | || || |||      |||||    | |||  |      |   || |  |  |      |  |||||  |       | |                          | |||       | | |     ||| || ^**     |  ||    |    | | |||| |||     |    ^**|  |  ||||  || | |||  |      | |||    | |  |  |   | |  |||          | |   ||^**^**       |  | | |     ^**|       |||||||| ||  |  |  |  |     | |   ||||   |..PS00005..|                  |  |            |  |       ^**|  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  | |  |  | |  |           |    |           ||   | |    |||   | |  | |  |  | ^*** || |||      |||||    | |||  |      |   || |  |  |      ^***||||  |       | |                          | |||       | | |     ||^*** | |     ^***|    |    | | |||| |||     |    |  |  |  ||||  || ^***|  |      | |||    | |  ^***   | |  |||          | |   |||| | |       ^*** | |      | |       ||||||^***|  |  |  ^***     | |   ||||   |..PS00006..|                  |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  | |  |  | |  |           ^*****           ||   | |    |^***** |  | |  |  | | |  || |||      |||||    | |||  |      ^***** |  |  |          |^*****       | |                          | |||       | | |     ^***** | |         |    ^***** | |||| |||     |    |  |  ^*****|  || | | |  |      | |||    | |  |  |   | |  |||          | |   |||| | |          | | |      | |       ^***** | ||  |  |           | |   ||||   ^..PS00008..*                  |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..         |  | |  |  | |  |                            ||   | |    | |     |  | |  |  | | |  || |||      |||||    | |||  |          |  |  |  |          | ||  |       | |                          | |||       | | |      |  || | |         **********************     |    |  |  |  || |  || | | |  |      | |||    | |  |  |   | |  |||          | |   |||| | |          | | |      | |        ||||| | ||  |  |           | |   ||||    ..PS00029..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  SULFATASE_2 ..         |  | |  |  | |  |                            ||   | |    | |     |  | |  |  | | |  || |***********||    | |||  |          |  |  |  |          | ||  |       | |                          | |||       | | |      |  || | |                     | |||| ||      |    |  |  |  || |  || | | |  |      | |||    | |  |  |   | |  |||          | |   |||| | |          | | |      | |        ||||| | ||  |  |           | |   ||||    ..PS00149..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  | |  |  | |  |                            ||   | |    | |     |  | |  |  | | |  || |||      |||||    | |||  |          |  |  |  |          | ||  |       | |                          | |||       | | |      |  || | |                     | |||| ||      |    |  |  |  || |  || | | |  |      | |||    | |  |  |   | *****|          | |   |||| | |          | | |      | |        ||||| | ||  |  |           | |   ||||    ..alphabetamotif..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  | |  |  | |  |                            ||   | |    | |     |  | |  |  | | |  || |||      |||||    | |||  |          |  |  |  |          | ||  |       | |                          | |||       | | |      |  || | |                     | |||| ||      |    |  |  |  || |  || | | |  |      | |||    | |  |  |   | |  | |          | |   |||| | |          *****      | |        ||||| | ||  |  |           | |   ||||    ..asxmotif..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  | |  |  | |  |                            ||   | |    | |     |  | |  |  | | |  || |||      |||||    | |||  |          |  |  |  |          | ||  |       | |                          | |||       | | |      |  || | |                     | |||| ||      |    |  |  |  || |  || | | |  |      | |||    | |  |  |   | |  | |          ***   |||| | |          ***        | |        ||||| | ||  |  |           ***   ||||    ..asxturn..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | |  **** |  |                            ||   | |    | |     **** |  |  | | |  |****|      |||||    | ||****          ****  ****          | ||  |       | |                          ****|       | | |      |  || | |                     ********|      |    ****  |  ****  **** | |  |      ****|    | |  ****   | **** |                |||| | |                     | |        ****| | ||  ****                 ||||    ..betaturn..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | |  |  ***  |                            ||   ***    ***     |  | |  |  | | |  |  ***      |****    ***|              |     |  |          | ||  |       | |                            ***       | | |      |  |*** |                       ****  |      |       |  |   | |  || | | |  |        ***    | |     |   |    ***                **** | |                     | |        ||||| | ||  |  |                 ****    ..nest..                   |  |            |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ****    ****                            ||   | |            ******  **** | |  |    |      | |      ****              |     ****          *******       ***                                      *** |      ******* |                          ****      |       ****   ***  ****** ****               ***     |   |                            ***                     ***        |***************                         ..niche..                   ****            ****          ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                      ||   | |                         | |  ******      | |                        |                                                                          | | |            | |                                    |                    |                                |   |                                                               | | |                                    ..schellmannloop..                                                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                      ||   | |                         | |              | |                        |                                                                          | | |            | |                                    |                    |                                |   |                                                               *****                                    ..stmotif..                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                      |***** |                         | |              | |                        |                                                                          | | |            | |                                    |                    |                                *****                                                               | |                                      ..ststaple..                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                      |    ***                         ***              | |                        |                                                                          *** |            ***                                    |                    |                                                                                                    ***                                      ..stturn..                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                      *                                                 * *                        *                                                                              *                                                   *                    *                                                                                                                                             ..REP00000..                                                        

   New search    1auk:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors