triangle PDBeMotif: 1aot  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification complex (proto-oncogene/early protein)    | release date: Thu, Jul 10, 1997
Title nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure
Authors A.J.DAY, C.J.MORTON, G.L.SHAW, I.D.CAMPBELL, T.D.MULHERN
Method SOLUTION NMR
PDBe Citation   
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain F sequence:
SIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFE
TLQQLVQHYSERAAGLSSRLVVPSHK
Chain P sequence:
EPQYEEIPIYL
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain F : FYN PROTEIN-TYROSINE KINASE
member of: GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF44PFAM:searchPF00017PFAMB:searchPB005637PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP06241
sec str:  ...............hhhhhhhhh.......................eee.........eee...eee...eee.........hhhhhhhh.................
sequence :  ..SIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLSSRLVVPSHK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |      |  | |  | | || |  |       ^**     ^**|              | | ||||  ^**      |  |  |^**| | ^**    ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |      |  | |  | | || |  |               ^***              | | ||||           |  |  |  || |           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | |      |  | |  | | || |  |                                 *******^           |  |  |  || |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |      |  | |  | | |^*****                                   | |||            |  |  |  || |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | |      ^*** |  | | |  |  |                                   | |||            |  |  |  || |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |           |  | | |  |  |                                   *****            |  |  |  || |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |           **** | |  |  |                                   ****|            ****  |  || |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |                ***  |  |                                     | |                  |  || |           
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                     |  |                                     ***                  |  |***           
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                                                          ****              

chain P : PHOSPHOTYROSYL PEPTIDE
member of: UniProt:searchP03079
sec str:  .....eee.....
sequence :  ..EPQYEEIPIYL
seq num:  ..201        

   New search    1aot:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML