triangle PDBeMotif: 1amo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.6.2.4
Classification oxidoreductase    | release date: Tue, Jun 17, 1997
Title three-dimensional structure of nadph-cytochrome p450 reductase: prototype for fmn-and fad-containing enzymes
Authors B.S.S.MASTERS, D.L.ROBERTS, J.J.P.KIM, M.WANG, R.PASCHKE, T.M.SHEA
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search FMN FMN binding statistics FMN   search NAP NAP binding statistics NAP   search FAD FAD binding statistics FAD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
VKESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDKSLVVFCMATYGEG
DPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQF
WPAVCEFFGVEATGEESSIRQYELVVHEDMDVAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTANRKLNQGTERHLMHL
ELDISDSKIRYESGDHVAVYPANDSALVNQIGEILGADLDVIMSLNNLDEESNKKHPFPCPTTYRTALTYYLDITNPPRT
NVLYELAQYASEPSEQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSK
VHPNSVHICAVAVEYEAKSGRVNKGVATSWLRAKEPAGENGGRALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPFMGF
IQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQAHKVYVQHLLKRDREHLWKLIHEG
GAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHTQAVDYVKKLMTKGRYSLDVWS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NADPH-CYTOCHROME P450 REDUCTASE
member of: CATH:search1.20.990.10/search2.40.30.10/search3.40.50.360/search3.40.50.80GENE3D:searchG3DSA_1.20.990.10/searchG3DSA_2.40.30.10/searchG3DSA_3.40.50.360/searchG3DSA_3.40.50.80PANTHER:searchPTHR19384PFAM:searchPF00175/searchPF00258/searchPF00667PIRSF:searchPIRSF000208PRINTS:searchFLAVODOXIN/searchFPNCRPROSITE PROFILES:searchPS50902/searchPS51384, SUPERFAMILY:searchSSF52218/searchSSF52343/searchSSF63380UniProt:searchP00388
JMol viewer RasMol script viewer  NAP 752A  ..                                                                                                                                                                            ..NAP ..                                                       *                                                                                                                                                                                                         ..NAP ..                           **                              **                            **    * * *                             *  *                                       
JMol viewer RasMol script viewer  FMN 751A  ..                      *** **                                              **** *                             ***  * ***                         *   *                       ..FMN ..                                                       |                                                                                                                                                                                                         ..FMN ..                           ||                              ||                            ||    | | |                             |  |                                       
JMol viewer RasMol script viewer  FAD 750A  ..                      ||| ||                                              |||| |                             |||  | |||                         |   |                       ..FAD ..                                                       |                    *                                                                                                        *                             ****              *** * *         ****        ..FAD ..                           ||  *                           ||                            ||    | | |                             |  |                                     * 
sec str:  .......hhhhhhhh...eeeeee....hhhhhhhhh...hhh....eeee.hhh..hhhhhhhhh....eeeeeee........hhhhhhhhhhhh.........eeeeeee........hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhhhhhhhh....... ..............hhh........................eeeeeeeeee........eeeeeee............eeee.....hhhhhhhhhhh............................hhhhhhh.........hhhhhhhhhh...hhhhhhhhh......hhhhhhhhh.......hhhhhhh.......hhhhhhh......eeee..........eeeeeee..eee.....eee.hhhhhhhh...... ...eeeeeee.............eeeeeehhhhhhhhhhhhhhhhhhh.......eeeeeee.........hhhhhhhhh.....eeeeee.........hhhhhhh.hhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhh....hhhhhhhhhhhhh...eeeeee.
sequence :  ..VKESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDKSLVVFCMATYGEGDPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEFFGVEA... ..RQYELVVHEDMDVAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTANRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQIGEILGADLDVIMSLNNLDEESNKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNKGVATSWLRAKEP... ..ALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPFMGFIQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQAHKVYVQHLLKRDREHLWKLIHEGGAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHTQAVDYVKKLMTKGRYSLDVWS
seq num:  ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224         ... ..243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493    ... ..507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |||   | |      |  |||| |   |       |       ||| |   || || ||  |       |  |   |  ||        | ||||||   |    ^***   | |  ||   || |||             |   |  | ||         |||||..PS00001..|           |  | | |    | |                 ||  | |  | |           | |  |  |       ^***     || |||           |  | |        | |    | ||  |         || || | |  |   |  ||  |  |   |    | |        | |||      |  |        |   | | |  |             | |   |   ||| ||| ..PS00001..         | |  | |  |                      |  || |       | | ||||||  | |       ||||          | |                     | |    |        |   |  |         |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |||   ^**      |  |||| |   |       |       ||| |   || || ||  |       |  |   |  ||        | ||||||   |    |  |   | |  ||   || |||             |   |  ^**|         |||||..PS00005..*           |  | | |    | |                 ||  | |  ^**           | |  |  |                || |||           |  ^**        ^**    | ||  |         || || | |  |   |  ||  |  |   |    | |        | ^**      |  |        |   ^** |  |             ^**   |   ||| ||| ..PS00005..         | |  | |  |                      |  || |       | | ||||||  | |       ||||          | |                     | |    |        |   |  |         |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***|   | |      |  ||^***   |       |       ||| |   || ^***|  |       ^***   |  ||        ^***||||   |    |  |   | |  ||   || |||             |   |  ^***         |||||..PS00006..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || | ^***   |  |^***  |   |    | |        | |||      |  |        |       |  |             | |   |   ||| ||| ..PS00006..         | |  | |  |                      |  || |       | | ||^***  | |       ||||          | |                     | |    |        |   ^***         |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | | |   | |      |  ||||     ********^       ||| |   || ||  |  |              |  ||        | ||||||   |    |  |   | |  ||   || |||             |   |               |||||..PS00007..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   ||| ||| ..PS00007..         | |  | |  |                      |  || ********^ | ********^ |       ||||          | |                     | |    |        |   |            |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | | |   | |      ^*****|                     ||| |   || ||  |  |              |  ||        | ||||^*****    |  |   | |  ||   || |||             |   |               |^***..PS00008..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   ^*****| ||| ..PS00008..         | |  | |  |                      |  || |         ^*****||  | |       ||||          | |                     | |    |        |   |            |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | | |   | |         ||||                     ||| |   || ||  |  |              *****        | |||| |        |  |   | *****   || |||             |   |               |||||..alphabetamotif..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..alphabetamotif..         | |  | |  |                      ***** |            *****  | |       ||||          | |                     | |    |        |   |            *****  || | |||||      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | | |   | |         ||||                     ||| |   || ||  |  |              |  |         | |||| |        |  |   | |  |    || |||             *****               |||||..asxmotif..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..asxmotif..         | |  | |  |                      |  || |            |  |   | |       ||||          | |                     | |    |        |   |            |  |   || | |||||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | | |   | |         ||||                     *** |   || ||  |  |              |  |         | |||| |        |  |   | |  |    || |||                                 |||||..asxturn..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..asxturn..         | |  | |  |                      |  || |            |  |   | |       ||||          | |                     | |    |        |   |            |  |   || | |||||      
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | | |   | |         ||||                      |  |   || ||  |  |              |  |         | |||| |        |  |   | |  |    || |||                                 |||||..betabulge..            |  | | |    | |                 **  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..betabulge..         | |  | |  |                      |  || |            |  |   | |       ||||          | |                     | |    |        |   |            |  |   || | |||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | | |   | |         ||||                      |  |   ********  |              ****         | ||****        |  |   | ****    *****|                                 |||||..betaturn..            |  | | |    | |                     | |                | |  ****                |****|           ****                 | ||  |         ****| |        ****      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..betaturn..         | |  | |  |                      ****| |            ****   | |       ||||          | |                     | |    |        |   |            ****   **** |||||      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | | |   | |         ||||                      |  |       |  |  |                           | |||| |        |  |   | |          | |                                 |||||..gammaturn..            |  | | |    | |                     | |                | |  |  |                |  | |           |  |                 | ||  |          |  | |        |  |      |   |    | |        | ***      |  |        |       |  |             | |   |   | | *** ..gammaturn..         | |  | |  |                          | |                   | |       ||||          | |                     | |    |        |   |                    |   |||||      
search RasMol script viewer Motif-ligand binding stats  nest ..    | | |   ***         ****                      |  |       |  |  |                           | |||| |        |  |   ***          ***                                 *****..nest..            |  | ***    ***                     | |                ***  |  |                |  ***           |  |                 | ||  |          |  | |        |  |      |   |    ***        |  |       |  |        |       |  |             ***   |   | |  |  ..nest..         | |  | |  |                          ***                   ***       ****          | |                     ***    |        |   |                    |   |****      
search RasMol script viewer Motif-ligand binding stats  niche ..    | | |   |                                     ****       *******                           | |*****        ****                                                         ..niche..            ****                                ***                | |  ****                |    |           ****                 *******          ******        ****      |   |               ****       ****        |       ****                   |   | ****  ..niche..         ***  ******                                                                        ***                            |        |   |                    |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..    | | |   |                                                                                  | |                                                                          ..schellmannloop..                                                                   | |                      ******                                                                         |   |                                      |                              |   |       ..schellmannloop..         | |                                                                                                               |        |   |                    |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..    | | *****                                                                                  | |                                                                          ..ststaple..                                                                   | |                                                                                                     *****                                      |                              *****       ..ststaple..         | |                                                                                                               |        *****                    *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..    ***                                                                                        ***                                                                          ..stturn..                                                                   ***                                                                                                                                                |                                          ..stturn..         ***                                                                                                               |                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                            ..REP00000..                                                                                                                                                                                                                      *                                          ..REP00000..                                                                                                                           *                                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : NADPH-CYTOCHROME P450 REDUCTASE
member of: CATH:search1.20.990.10/search2.40.30.10/search3.40.50.360/search3.40.50.80GENE3D:searchG3DSA_1.20.990.10/searchG3DSA_2.40.30.10/searchG3DSA_3.40.50.360/searchG3DSA_3.40.50.80PANTHER:searchPTHR19384PFAM:searchPF00175/searchPF00258/searchPF00667PIRSF:searchPIRSF000208PRINTS:searchFLAVODOXIN/searchFPNCRPROSITE PROFILES:searchPS50902/searchPS51384, SUPERFAMILY:searchSSF52218/searchSSF52343/searchSSF63380UniProt:searchP00388
JMol viewer RasMol script viewer  NAP 752B  ..                                                                                                                                                                            ..NAP ..                                                       *                                                                                                                                                                                                         ..NAP ..                           **                              **                            **    * * *                             *  *                                       
JMol viewer RasMol script viewer  FMN 751B  ..                      *** **                                              **** *                             ***  * ***                         *   *                       ..FMN ..                                                       |                                                                                                                                                                                                         ..FMN ..                           ||                              ||                            ||    | | |                             |  |                                       
JMol viewer RasMol script viewer  FAD 750B  ..                      ||| ||                                              |||| |                             |||  | |||                         |   |                       ..FAD ..                                                       |                    *                                                                                                        *                             ****              *** * *         ****        ..FAD ..                           ||  *                           ||                            ||    | | |                             |  |                                     * 
sec str:  .......hhhhhhhh...eeeeee....hhhhhhhhh...hhh....eeee.hhh..hhhhhhhhh....eeeeeee........hhhhhhhhhhhh.........eeeeeee........hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhhhhhhhh....... ..............hhh........................eeeeeeeeee........eeeeeee............eeee.....hhhhhhhhhhh............................hhhhhhh.........hhhhhhhhhh...hhhhhhhhh......hhhhhhhhh.......hhhhhhh.......hhhhhhh......eeee..........eeeeeee..eee.....eee.hhhhhhhh...... ...eeeeeee.............eeeeeehhhhhhhhhhhhhhhhhhh.......eeeeeee.........hhhhhhhhh.....eeeeee.........hhhhhhh.hhhhhhhhhh...eeeeeee...hhhhhhhhhhhhhhhh....hhhhhhhhhhhhh...eeeeee.
sequence :  ..VKESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDKSLVVFCMATYGEGDPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEFFGVEA... ..RQYELVVHEDMDVAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTANRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQIGEILGADLDVIMSLNNLDEESNKKHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNKGVATSWLRAKEP... ..ALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPFMGFIQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQAHKVYVQHLLKRDREHLWKLIHEGGAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHTQAVDYVKKLMTKGRYSLDVWS
seq num:  ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224         ... ..243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493    ... ..507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |||   | |      |  |||| |   |       |       ||| |   || || ||  |       |  |   |  ||        | ||||||   |    ^***   | |  ||   || |||             |   |  | ||         |||||..PS00001..|           |  | | |    | |                 ||  | |  | |           | |  |  |       ^***     || |||           |  | |        | |    | ||  |         || || | |  |   |  ||  |  |   |    | |        | |||      |  |        |   | | |  |             | |   |   ||| ||| ..PS00001..         | |  | |  |                      |  || |       | | ||||||  | |       ||||          | |                     | |    |        |   |  |         |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |||   ^**      |  |||| |   |       |       ||| |   || || ||  |       |  |   |  ||        | ||||||   |    |  |   | |  ||   || |||             |   |  ^**|         |||||..PS00005..*           |  | | |    | |                 ||  | |  ^**           | |  |  |                || |||           |  ^**        ^**    | ||  |         || || | |  |   |  ||  |  |   |    | |        | ^**      |  |        |   ^** |  |             ^**   |   ||| ||| ..PS00005..         | |  | |  |                      |  || |       | | ||||||  | |       ||||          | |                     | |    |        |   |  |         |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***|   | |      |  ||^***   |       |       ||| |   || ^***|  |       ^***   |  ||        ^***||||   |    |  |   | |  ||   || |||             |   |  ^***         |||||..PS00006..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || | ^***   |  |^***  |   |    | |        | |||      |  |        |       |  |             | |   |   ||| ||| ..PS00006..         | |  | |  |                      |  || |       | | ||^***  | |       ||||          | |                     | |    |        |   ^***         |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | | |   | |      |  ||||     ********^       ||| |   || ||  |  |              |  ||        | ||||||   |    |  |   | |  ||   || |||             |   |               |||||..PS00007..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   ||| ||| ..PS00007..         | |  | |  |                      |  || ********^ | ********^ |       ||||          | |                     | |    |        |   |            |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | | |   | |      ^*****|                     ||| |   || ||  |  |              |  ||        | ||||^*****    |  |   | |  ||   || |||             |   |               |^***..PS00008..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   ^*****| ||| ..PS00008..         | |  | |  |                      |  || |         ^*****||  | |       ||||          | |                     | |    |        |   |            |  ||  || | |||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | | |   | |         ||||                     ||| |   || ||  |  |              *****        | |||| |        |  |   | *****   || |||             |   |               |||||..alphabetamotif..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..alphabetamotif..         | |  | |  |                      ***** |            *****  | |       ||||          | |                     | |    |        |   |            *****  || | |||||      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | | |   | |         ||||                     ||| |   || ||  |  |              |  |         | |||| |        |  |   | |  |    || |||             *****               |||||..asxmotif..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..asxmotif..         | |  | |  |                      |  || |            |  |   | |       ||||          | |                     | |    |        |   |            |  |   || | |||||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | | |   | |         ||||                     *** |   || ||  |  |              |  |         | |||| |        |  |   | |  |    || |||                                 |||||..asxturn..            |  | | |    | |                 ||  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..asxturn..         | |  | |  |                      |  || |            |  |   | |       ||||          | |                     | |    |        |   |            |  |   || | |||||      
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | | |   | |         ||||                      |  |   || ||  |  |              |  |         | |||| |        |  |   | |  |    || |||                                 |||||..betabulge..            |  | | |    | |                 **  | |                | |  |  |                || |||           |  |                 | ||  |         || || |        |  |      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..betabulge..         | |  | |  |                      |  || |            |  |   | |       ||||          | |                     | |    |        |   |            |  |   || | |||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | | |   | |         ||||                      |  |   ********  |              ****         | ||****        |  |   | ****    *****|                                 |||||..betaturn..            |  | | |    | |                     | |                | |  ****                |****|           ****                 | ||  |         ****| |        ****      |   |    | |        | |||      |  |        |       |  |             | |   |   | | ||| ..betaturn..         | |  | |  |                      ****| |            ****   | |       ||||          | |                     | |    |        |   |            ****   **** |||||      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | | |   | |         ||||                      |  |       |  |  |                           | |||| |        |  |   | |          | |                                 |||||..gammaturn..            |  | | |    | |                     | |                | |  |  |                |  | |           |  |                 | ||  |          |  | |        |  |      |   |    | |        | ***      |  |        |       |  |             | |   |   | | *** ..gammaturn..         | |  | |  |                          | |                   | |       ||||          | |                     | |    |        |   |                    |   |||||      
search RasMol script viewer Motif-ligand binding stats  nest ..    | | |   ***         ****                      |  |       |  |  |                           | |||| |        |  |   ***          ***                                 *****..nest..            |  | ***    ***                     | |                ***  |  |                |  ***           |  |                 | ||  |          |  | |        |  |      |   |    ***        |  |       |  |        |       |  |             ***   |   | |  |  ..nest..         | |  | |  |                          ***                   ***       ****          | |                     ***    |        |   |                    |   |****      
search RasMol script viewer Motif-ligand binding stats  niche ..    | | |   |                                     ****       *******                           | |*****        ****                                                         ..niche..            ****                                ***                | |  ****                |    |           ****                 *******          ******        ****      |   |               ****       ****        |       ****                   |   | ****  ..niche..         ***  ******                                                                        ***                            |        |   |                    |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..    | | |   |                                                                                  | |                                                                          ..schellmannloop..                                                                   | |                      ******                                                                         |   |                                      |                              |   |       ..schellmannloop..         | |                                                                                                               |        |   |                    |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..    | | *****                                                                                  | |                                                                          ..ststaple..                                                                   | |                                                                                                     *****                                      |                              *****       ..ststaple..         | |                                                                                                               |        *****                    *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..    ***                                                                                        ***                                                                          ..stturn..                                                                   ***                                                                                                                                                |                                          ..stturn..         ***                                                                                                               |                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                            ..REP00000..                                                                                                                                                                                                                      *                                          ..REP00000..                                                                                                                           *                                                

   New search    1amo:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML