triangle PDBeMotif: 1al6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.1.3.7
Classification lyase    | release date: Thu, Jun 12, 1997
Title chicken citrate synthase complex with n-hydroxyamido-coa and oxaloacetate
Authors K.C.USHER, S.J.REMINGTON
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search HAX HAX binding statistics HAX   search OAA OAA binding statistics OAA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ASSTNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPK
AGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAE
GINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEG
GNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGH
AVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVS
RALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAGG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CITRATE SYNTHASE
member of: CATH:search1.10.230.10/search1.10.580.10GENE3D:searchG3DSA_1.10.580.10PANTHER:searchPTHR11739/searchPTHR11739_SF8PFAM:searchPF00285PRINTS:searchCITRTSNTHASEPROSITE PATTERNS:searchPS00480, SUPERFAMILY:searchSSF48256TIGRFAMS:searchTIGR01793UniProt:searchP23007
JMol viewer RasMol script viewer  HAX 700A  ..                                           *                                                                                                                     *                                                                                                            *** *                               *    ** *****                                            ***    * *                     *                                        
JMol viewer RasMol script viewer  OAA 702A  ..                                           |                                                                                                                     |                                                                         *   *                              |*| |                               |    || |||*|       *                                    |||    | |                     |   *                   *                
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhh.........hhhhh.............eeee...eeee....hhhhhhh...........hhhhhhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhhhhhhh.hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh...hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh................hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhh...
sequence :  ..STNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPKAGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAGG
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                    | |  |  |           | |  |    |  |  |      |  ||  | |  |  |  | |           | |   |  ||  |   |  |       | || ||  |             |  |       |||^***     |                      | ||| || |||||   ^*** | | | | |        | || || ^*** |    | |||| | |      |  |  |                  |   ||  |         | | | || |  ||  | |||         |  |   |    |  ||      |||| | | | |       | |||          |    |    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                    ^**  |  |           | |  |    |  |  |      |  ||  | |  |  |  | |           | |   |  ||  |   |  |       | || ||  |             |  |       |||| ||     |                      | ||| || |||||        | | | | |        | || || |||| |    | |||| | |      |  |  |                  |   ||  |         ^** | || |  ||  | |||         |  |   |    |  ||      |||| | | | |       | |||          |    |    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                         |  |           | |  |    |  ^***      |  |^*** |  |  |  | |           | |   |  ||  |   |  |       ^*** ||  |             |  |       |||| ||     |                      | ||| || |^***        | | | | |        | ^***| |||| |    | |||| | |      |  |  |                  |   ||  |         | | | || |  ||  | |||         |  |   |    |  ||      |||| | | | |       | |||          |    |    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                         |  |           | |  |    |  |         |  |     |  |  |  | |           | |   |  ||  |   |  |         |  ||  |             |  |       |||| |******^                      | ||| || | ||         | | | | |        |  | || |||| |    | |||| | |      |  |  |                  |   ||  |         | | | || |  |******^|         |  |   |    |  ||      |||| | | | |       | |||          |    |    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                         |  |           ^*****    |  |         |  |     |  |  |  | |           | |   |  ||  |   |  |         |  ||  |             |  |       |^*****                            | ^***** | ||         | | | | |        |  | |^***** |    ^***** | |      |  |  |                  ^*****  |         | | | || |  |   | |||         |  |   |    |  ||      |||| | | | |       | |||          ^*****    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  CITRATE_SYNTHASE ..                         |  |           | |  |    |  |         |  |     |  |  |  | |           | |   |  ||  |   |  |         |  ||  |             |  |       | || |                             |  || |  | ||         | | | | |        |  | |  |||  |    | |||| | |      |  |  |                      |   |         | | | ***^*********||         |  |   |    |  ||      |||| | | | |       | |||                    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         |  |           | |  |    |  |         |  |     |  |  |  | |           | |   |  ||  |   |  |         |  ||  |             |  |       | || |                             |  || |  | ||         | | | | |        |  | |  |||  |    | |||| | |      |  |  |                      |   |         | | |  | |  |   *****         |  |   |    *****      |||| | | | |       | |||                    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                         |  |           | |  |    |  |         |  |     |  |  |  | |           | |   |  ||  |   |  |         |  ||  |             |  |       | || |                             |  || |  | ||         | | | | |        |  | |  |||  |    | |||| | |      |  |  |                      |   |         | | |  | |  |   |  |          |  *****    |  |       |||| | | | |       | |||                    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         |  |           | |  |    |  |         |  |     |  |  |  | |           | |   |  ||  |   |  |         |  ||  |             |  |       | |***                             |  || |  ***|         | | *** |        |  | |  ***  |    | |||*** |      |  |  |                      |   |         | | |  | |  |   |  |          |  |        |  |       |||| | | ***       | |||                    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         ****           | ****    |  |         ****     |  |  **** |           | |   |  ||  |   |  |         |  ||  |             ****       | |                                ****| |  |  |         | | |   |        |  | |  |||  |    ****||   |      |  ****                      |   |         | | |  | |  |   ****          |  |        ****       |||| | |   |       ****|                    |   |  | |                    
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |           ***  |    |  |                  |  |  |  | |           ***   |  ||  |   |  |         |  ||  |             |  |       ***                                |  || |  |  |         *** |   |        |  | |  |||  |      ***|   |      |  |  |                      |   |         *** |  | |  |                 |  |                   **** | |   |         ***                    |   |  ***                    
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****             ****    ****                  ****  ******           | |   |  ||  |   ****         ********             ****                                          ****| |  ****           ***   |        **** ****||  |         |   |      ****  |                      |   |             **** ****                 ****                        ***   |                                |   |                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                               | |   |  ||  |                                                                                       | |                   |   |                 ||  |         |   |            |                      *****                  |                                                      |                                |   |                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                               | |   ********                                                                                       | |                   *****                 *****         *****            |                                             |                                                      |                                *****                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                               ***                                                                                                  ***                                          |                             |                                             |                                                      |                                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                 *                             *                                             *                                                      *                                                              

   New search    1al6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors