triangle PDBeMotif: 1afw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.3.1.16
Classification thiolase    | release date: Sat, Mar 15, 1997
Title the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae
Authors M.MATHIEU, R.K.WIERENGA
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search MRD MRD binding statistics MRD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
KNSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHR
AACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLI
PMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGSICQSDEGPRPNVTAESLSSIRPAFIKD
RGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINE
AFAAQALYCIHKLGIDLNKVNPRGGAIALGHPLGCTGARQVATILRELKKDQIGVVSMCIGTGMGAAAIFIKE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 3-KETOACETYL-COA THIOLASE
member of: CATH:search3.40.47.10GENE3D:searchG3DSA_3.40.47.10PANTHER:searchPTHR18919/searchPTHR18919_SF69PFAM:searchPF00108/searchPF02803PIRSF:searchPIRSF000429PROSITE PATTERNS:searchPS00098/searchPS00099/searchPS00737, SUPERFAMILY:searchSSF53901TIGRFAMS:searchTIGR01930UniProt:searchP27796
JMol viewer RasMol script viewer  MRD 502B  ..                                                                                                                                                                                                                                              ..MRD ..                                                                                                                                                        
JMol viewer RasMol script viewer  MRD 501A  ..                                                                                                   *                                                         ***                                                                              ..MRD ..                                                                                                                                                        
sec str:  .............eeeeeeee...............hhhhhhhhhhhhhh...hhhhhhhhh..eeeee....hhhhhhhhhhhhhh.......eeeeee.hhhhhhhhhhhhhhhhhh....eeeeeeeeehhhhhhh.........hhhhh...hhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..............................hhhhhh......... ..............eeeeeeeeeehhhhhh......eeeeeeeeee..hhhhhhhhhhhhhhhhhhh...hhh..eeee....hhhhhhhhhhh...hhh......hhhh......hhhhhhhhhhhh.....eeeeeeee...eeeeeeeee.
sequence :  ..KNSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGSICQSDEGPRPNVTAESLSSIRPAFI... ..GTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGGAIALGHPLGCTGARQVATILRELKKDQIGVVSMCIGTGMGAAAIFIKE
seq num:  ..25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255     ... ..266       276       286       296       306       316       326       336       346       356       366       376       386       396       406         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | |  |      ^***        |  |             |  ||  |  || ||     ||  ||| | ||       ||||  |    | | ||           || ||||  |    | |   || ||| |||||||||  | |  |  |            | || |||              | |||||  |      | |    |  || ^***|  || |    ..PS00001..|  |||^***      |    |   || |||                 |||||  |    |   | ||| ||                || ||||| |||  |    | |  |  | |   | |  ||  | |    ||| |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | |  |                  |  |             |  ||  |  || ||     ||  ||| | ||       ||||  |    | | ||           || ||||  |    | |   || ||| |||||||||  | |  |  |            | |^**||              | |||||  |      | |    |  ||  |  |  |^**    ..PS00005..|  |||||        |    |   || |||                 |||||  |    |   | ||| ||                || ||||| |||  |    | |  |  | |   | |  ||  | |    ||| |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^*** |  |                  |  |             |  ||  |  || ||     ||  ||| | ||       ||||  |    | | ||           || ||||  |    | |   || ||| ||||^***|  | |  |  |            | |^***|              | |||||  |      | |    |  ||  |  |  |       ..PS00006..|  |||||        |    |   || |||                 |||||  |    |   | ||| ||                || ||||| |||  |    | |  |  | |   | |  ||  | |    ||| |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | |  |                  |  |             |  ||  |  || ||     ^*****^*****       |^*****    | | ||           || ||||  ^***** |   || ||| |^***** |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..PS00008..^*****||        ^*****   || |||                 ||^*****    |   | ||| ||                || |^*****||  ^***** |  ^*****   | |  ||  | |    ||^*****|      
search RasMol script viewer Motif-ligand binding stats  THIOLASE_1 ..  |  | |  |                  |  |             |  ||  |  || ||      |  |   | |        | ||  |    ****^************** ||||         |   || ||| |||| |  |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..PS00098..   |||||                 || |||                 || ||       |   | ||| ||                || ||||| |||         |     | |   | |  ||  | |    ||| |   |      
search RasMol script viewer Motif-ligand binding stats  THIOLASE_3 ..  |  | |  |                  |  |             |  ||  |  || ||      |  |   | |        | ||  |      | ||           || ||||         |   || ||| |||| |  |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..PS00099..   |||||                 || |||                 || ||       |   | ||| ||                || ||||| |||         |     | |   | |  ||  | *****^********      
search RasMol script viewer Motif-ligand binding stats  THIOLASE_2 ..  |  | |  |                  |  |             |  ||  |  || ||      |  |   | |        | ||  |      | ||           || ||||         |   || ||| |||| |  |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..PS00737..   |||||                 || |||                 || ||       |   | ||| ||                || ||||| ||***************** |   | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | |  |                  |  |             |  ||  |  || ||      |  |   | |        | ||  |      | ||           || ||||         |   || ||| |||| |  |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..alphabetamotif..   *****                 || |||                 || ||       |   | ||| ||                || ||||| ||          |       |   | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |  |                  |  |             |  ||  |  || ||      |  |   | |        | ||  |      | ||           || ||||         |   || ||*****| |  |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..asxmotif..   |||||                 || |||                 || ||       |   | ||| ||                || ||||| ||          |       |   | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |  |                  |  |             |  ||  |  || ||      |  |   | |        | ||  |      | ||           || ||||         |   || ||***| | |  |  | |  |  |            | ||   |              | |||||  |      | |    |  ||  |  |  |       ..asxturn..   |||||                 || |||                 || ||       |   | ||| ||                || ||||| ||          |       |   | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  **** |  |                  |  |             |  |***********      |  |   | |        | |****      ****           |****||         |   ****|**** | |  **** ****  |            | ||   |              ****|||  |      | |    |  ||  |  ****       ..betaturn..   ****|                 |****|                 *****       |   | |*****                |****|****|          |       |   | |  |****      |****          
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |  |                  |  |             |  |       |  |      |  |   ***        ***|  |        |            |  ****         |   ||  |   | | |  |  |    |  |            ***|   |                ****|  |      ***    |  ||  |             ..nest..   ||| |                 |  ***                             |   *** |  |                |  *** |  |          |       |   | |  ||  |      | |            
search RasMol script viewer Motif-ligand binding stats  niche ..  **** ****                  ****             ****       ****      ****                 ****        |            |    |          |   |****   *****  ****    ****               |   |                    ****             ********             ..niche..   |****                 |    |                             |   |   ****                |    | ****          |       |   | ********      | |            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                    |            ******          |   |                                         |   |                                                          ..schellmannloop..   | | |                 ******                             |   |                       ******               |       |   |               | |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    |                            *****                                         *****                                                          ..stmotif..   *****                                                    |   |                                            |       |   |               | |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    |                                                                                                                                         ..ststaple..   | |                                                      *****                                            |       *****               | |            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    |                                                                                                                                         ..stturn..   ***                                                                                                       |                           | |            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                                                                                         ..REP00000..                                                                                                             *                           * *            

chain B : 3-KETOACETYL-COA THIOLASE
member of: CATH:search3.40.47.10GENE3D:searchG3DSA_3.40.47.10PANTHER:searchPTHR18919/searchPTHR18919_SF69PFAM:searchPF00108/searchPF02803PIRSF:searchPIRSF000429PROSITE PATTERNS:searchPS00098/searchPS00099/searchPS00737, SUPERFAMILY:searchSSF53901TIGRFAMS:searchTIGR01930UniProt:searchP27796
JMol viewer RasMol script viewer  MRD 502B  ..                                                                                                   *                                                         ***                                                                                                                                                                                                                                         
JMol viewer RasMol script viewer  MRD 501A  ..                                                                                                   |                                                         |||                                                                                                                                                                                                                                         
sec str:  .............eeeeeeee...............hhhhhhhhhhhhhhh..hhhhh.hhh..eeeee....hhhhhhhhhhhhhh.......eeeeee.hhhhhhhhhhhhhhhhh.....eeeeeeeeehhhhhhh.........hhhh....hhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..............................hhhhhh.....................eeeeeeeeeehhhhhhh.....eeeeeeeeee..hhhhhhhhhhhhhhhhhhh...hhh..eeee....hhhhhhhhhhh...hhh......hhhh......hhhhhhhhhhhh.....eeeeeeee...eeeeeeeee.
sequence :  ..KNSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGSICQSDEGPRPNVTAESLSSIRPAFIKDRGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGGAIALGHPLGCTGARQVATILRELKKDQIGVVSMCIGTGMGAAAIFIKE
seq num:  ..25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | |  |      ^***   | |  |  |             |  |   |  ||  |     ||  ||| | ||       ||||  |    | | ||            | ||||  |    | |   || ||| |||||||||| |   || ||            | || |||     |  ||      |||| | |    | |||    |  |  ^***  ||||||  |   | ||||^***      |    |   || |||                 | |||  ||   ||| ||||| ||                   |||||||||  |    | |  |  ||| ||| |  ||  | |    ||| |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | |  |             | |  |  |             |  |   |  ||  |     ||  ||| | ||       ||||  |    | | ||            | ||||  |    | |   || ||| |||||||||| |   || ||            | |^**||     |  ||      |||| | |    | |||    |  |     |  ||^**|  |   | |||| |        |    |   || |||                 | |||  ||   ||| ||||| ||                   |||||||||  |    | |  |  ||| ||| |  ||  | |    ||| |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^*** |  |             | |  |  |             |  |   |  ||  |     ||  ||| | ||       ||||  |    | | ||            | ||||  |    | |   || ||| ||||^***|| |   || ||            | |^***|     |  ||      |||| | |    | |||    |  |     |  || | |  |   | |||| |        |    |   || |||                 | |||  ||   ||| ||||| ||                   |||||||||  |    | |  |  ||| ||| |  ||  | |    ||| |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | |  |             | |  |  |             |  |   |  ||  |     ^*****^*****       |^*****    | | ||            | ||||  ^***** |   || ||| |^***** || |   || ||            | ||   |     |  ||      |||| | |    | |||    |  |     |  || | |  |   ^***** |        ^*****   || |||                 | ^*****|   ||| ||||| ||                   |^*****||  ^***** |  ^***** ||| |  ||  | |    ||^*****|      
search RasMol script viewer Motif-ligand binding stats  THIOLASE_1 ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |    ****^************** ||||         |   || ||| |||| |  || |   || ||            | ||   |     |  ||      |||| | |    | |||    |  |     |  || | |  |   | |||| |                 || |||                 |  ||  ||   ||| ||||| ||                   | |||||||  |      |     ||| ||| |  ||  | |    ||| |   |      
search RasMol script viewer Motif-ligand binding stats  THIOLASE_3 ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |      | ||              ||||         |   || ||| |||| |  || |   || ||            | ||   |     |  ||      |||| | |    | |||    |  |     |  || | |  |   | |||| |                 || |||                 |  ||  ||   ||| ||||| ||                   | |||||||  |      |     ||| ||| |  ||  | *****^********      
search RasMol script viewer Motif-ligand binding stats  THIOLASE_2 ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |      | ||              ||||         |   || ||| |||| |  || |   || ||            | ||   |     |  ||      |||| | |    | |||    |  |     |  || | |  |   | |||| |                 || |||                 |  ||  ||   ||| ||||| ||                   | ||||||*****************|| ||| |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |      | ||              ||||         |   || ||| |||| |  || |   || ||            | ||   |     *****      |||| | |    | |||    |  |     ***** | |  |   | |||| |                 || |||                 |  |*****   ||| ||||| ||                   | |||||||  |      |      *****| |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |      | ||              ||||         |   || ||*****| |  || |   || ||            | ||   |     |  |       |||| | |    | |||    |  |     |  |  | |  |   | |||| |                 || |||                 |  ||  |    ||| ||||| ||                   | |*****|  |      |      || | | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |      | ||              ||||         |   || ||***| | |  || |   || ||            | ||   |     |  |       |||| | |    | ***    |  |     |  |  | |  |   | |||| |                 || |||                 |  ||  |    ||| ||||| ||                   | |***|||  |      |      || | | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  | |  |             | |  |  |             |  |   |  ||  |      |  |   | |        | ||  |      | ||              ||||         |   || |||  | | |  || |   || ||            | ||   |     |  |       |||| | |    *****    |  |     |  |  | |  |   | |||| |                 || |||                 |  ||  |    ||| ||||| ||                   | ||| |||  |      |      || | | |  ||  |      ||| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |  |             | |  ****             ****   ********      |  |   | |        | |****      ****              ||||         |   ****|**** | |  ****   ****|            | ||   |     ****       |||| | |    ****|    |  |     ******* |  |   | |||| |                 |****|                 ********    ||****|*****                   | |****|****      |      **** | |  |****      |****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  | |  |             ***  |  |             |  |       |  |      |  |   | |        | ||  |        |               ||||         |   ||  |   | | |  || |    |  |            | ||   |                |||| | |      | |    |  |        |  | |  |   | |||| |                 |  | |                             ||  | | |  |                   | | |  |          |       |   | |  ||  |      | |            
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |  |                  |  |             |  |       |  |      |  |   ***        ***|  |        |               ****         |   ||  |   | | |  || |    |  |            ***|   |                **** | |      ***    |  |        |  | |  |   | |||| |                 |  ***                             ||  *** |  |                   *** |  |          |       |   | |  ||  |      | |            
search RasMol script viewer Motif-ligand binding stats  niche ..  **** ****                  ****             ****       ****      ****                 ****        |                            |   |****   *****  ****    ****               |   |                     ***             ****        **** ****   ***|****                 |    |                             ||  | | ****                       ****          |       |   | ********      | |            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                    |                            |   |           |   |                         |   |                                                                | |                   ******                             |******                                          |       |   |               | |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    |                            *****           *****                         *****                                                                | |                                                      |   |                                            |       |   |               | |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    |                                                                                                                                               | |                                                      *****                                            |       *****               | |            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    |                                                                                                                                               ***                                                                                                       |                           | |            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                                                                                                                                                                                                         *                           * *            

   New search    1afw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors