triangle PDBeMotif: 1a8m  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lymphokine    | release date: Fri, Mar 27, 1998
Title tumor necrosis factor alpha, r31d mutant
Authors C.REED, I.T.WEBER, J.WU, M.-J.CHEN, R.W.HARRISON, Y.-N.XUE, Z.-Q.FU
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNDRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTI
SRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR NECROSIS FACTOR ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ........eeeeeee.................eee...eee..eeee...eeeeeeeeeeeeeee.......eeeeeeeee...eeeeeeeeeee.............eeeeeeeeeeeeeee..eeeeeeee.hhhhh.......eeeeeeee
sequence :  ..RTPSDKPVAHVVANPQAEGQLQWLNDRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*| ^**                 |  | | |           |               |   |    || |                         |||| | |  |      |       |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|                 |  | | |           |               |   |    || |                         |||| | |  |      |       |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |                 |  | | |           |               |   |    || |                         |||| | |  *******^       |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |                 |  | | |           |               |   ^*****| |                         |||| | |  |              |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..   | |                 |  | | |           *****************         | |                         |||| | |  |              |  |       || ||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |                 |  | | |                                     | |                         |||| | |  |              |  |       *****               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |                 |  | ***                                     | |                         ****** |  |              |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  nest ..   | |                 |  |                                         ***                                |  |              |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                 ****                                                                            ****              ****        ****               

chain B : TUMOR NECROSIS FACTOR ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ........eeeeeee.................eee...eee..eeee...eeeeeeeeeeeeeee.......eeeeeeeee...eeeeeeeeeee.............eeeeeeeeeeeeeee..eeeeeeee.hhhhh.......eeeeeeee
sequence :  ..RTPSDKPVAHVVANPQAEGQLQWLNDRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*| ^**       | |                          |               |   |    |            | |                       |      |       |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|       | |                          |               |   |    |            | |                       |      |       |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |       | |                          |               |   |    |            | |                       *******^       |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |       | |                          |               |   ^*****            | |                                      |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..   | |       | |                          *****************                     | |                                      |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |       ***                                                                | |                                      |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |                                                                          ***                                      |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  nest ..   | |                                                                                                                   |  |        |  |     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                                                                                                                   ****        ****               

chain C : TUMOR NECROSIS FACTOR ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ........eeeeeee.................eee...eee..eeee...eeeeeeeeeeeeeee.......eeeeeeeee...eeeeeeeeeee.............eeeeeeeeeeeeeee..eeeeeeee.hhhhh.......eeeeeeee
sequence :  ..RTPSDKPVAHVVANPQAEGQLQWLNDRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*| ^**        | | |||| |  |           |  ||               |   |    |             | |   ||                 |      |       |  |            | |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***         | | |||| |  |           |  ||               |   |    |             | |   ||                 |      |       |  |            | |  | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              | | |||| |  |           |  ||               |   |    |             | |   ||                 *******^       |  |            | |  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | | |||| |  |           |  ||               |   ^*****             | |   ||                                |  |            | |  | |       
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..              | | |||| |  |           |  |*****************                      | |   ||                                |  |            | |  | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | | |||| |  |           |  |                                       | |   ||                                |  |            ***  | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | | |||| |  |           |  |                                       | |   **                                |  |                 | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | | |||| |  |           ****                                       | |                                     ****                 | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              *** |||| |  |                                                      | |                                     |  |                 | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                  **** |  |                                                      ***                                     |  |                 | |       
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                                                                                              ****                 ***       

   New search    1a8m:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors