triangle PDBeMotif: 1a85  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.24.34
Classification hydrolase/hydrolase inhibitor    | release date: Fri, Apr 3, 1998
Title mmp8 with malonic and asparagine based inhibitor
Authors E.G.V.ROEDERN, F.GRAMS, H.BRANDSTETTER, R.A.ENGH
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search CA CA binding statistics CA   search 0DY 0DY binding statistics 0DY
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAF
QPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MMP-8
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF37PFAM:searchPF00413PIRSF:searchPIRSF001191PRINTS:searchMATRIXINSMART:searchSM00235SUPERFAMILY:searchSSF55486UniProt:searchP22894
JMol viewer RasMol script viewer  0DY 1A  ..                                                                         ****                               *   **  *     *      * ****                       
JMol viewer RasMol script viewer  ZN 999A  ..                                                                         ||||                               |   *|  *     |      | ||||                       
JMol viewer RasMol script viewer  ZN 998A  ..                                                              * *        ||||*            *                 |   ||  |     |      | ||||                       
JMol viewer RasMol script viewer  CA 997A  ..                                                              | |    ** *|*|||            | *  *            |   ||  |     |      | ||||                       
JMol viewer RasMol script viewer  CA 996A  ..                                                    *         | |    || ||||||      * * * | |  |            |   ||  |     |      | ||||                       
sec str:  .........eeeeee........hhhhhhhhhhhhhhhhhh...eeee.......eeeeee.................eee..........eeee.............hhhhhhhhhhhhh...........................hhhhhhhh....
sequence :  ..NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
seq num:  ..85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | ^***|    |  ||  || ||| |||   |  | |     |  |            ||||  |            | |||||   | ||   ^***  | | || || || |||  ||| ||||| |    |||^***      |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | | ^**    |  ||  || ||| |||   |  | |     |  |            ||||  |            | |||||   | ||    | |  | | || || || |||  ||| ||||| |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |        |  |^***| ||| |||   |  | |     ^***            |||^***            | |||||   | ||    | |  | | || || || |||  ||| ||||| |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |        |  |   || ||| |||   |  | |                     ||||               ^*****|   | ||    | |  | | || || || |^*****| ||||| |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..     | |        |  |   || ||| |||   |  | |                     ||||                 ||| |   | ||    | |  | | ***^^**^**||  | | ||||| |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |        |  |   |*********   |  | |                     ||||                 ||| |   | ||    | |  | | ||  | || |||  | | ||||| |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     | |        |  |   || ||| ||    |  | |                     ||||                 ||| |   | ||    | |  *****|  | || |||  | *****|| |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |        |  |   || ||| ||    |  | |                     |***                 ||| |   ***|    | |    |  |  | || |||  | ***| || |    ||| |        |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |        |  |   *********    |  | |                     ||||                 |****   |  |    | |    ****  | *****|  | **** || |    ||| |        ****   
search RasMol script viewer Motif-ligand binding stats  nest ..     | |        |  |                |  | |                     ****                 ||| |   |  |    | |          | |  ***  | |  | || |    ||| |               
search RasMol script viewer Motif-ligand binding stats  niche ..     ***        ****                ******                                          *****   ****    ***          | |    |  ***********    *****               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                 | ******  | |    |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                 |         ***    |                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                 *                *                           

   New search    1a85:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML