Target 15 Cancellation
Dear CAPRI participants,
We have to cancel Target 15 at the very last minute,
because EMBO Journal was unexpectedly efficient in
processing the paper by Graille et al., and some of you
have seen it on the Web site of the journal. As the PDB
will release the coordinates in coming days, those of
you who had their predictions ready will be able to
assess them.
Sorry once again!
The Management Committee
Target 15 is now available in the PDB as
PDB entrry 1v74
Targets T16 and T17 Cancellation
On behalf of the Management Committe, I'm sorry to
inform you that Targets 16 and 17 have been cancelled.
The Web page of the Gemini EU project on amylases
http://www.ifr.bbsrc.ac.uk/Gemini/results.html
displays a picture of the X-ray structures. We thank
Michael Tress in Madrid for pointing that out. The picture
has been on the Web since early January, making it
impossible to guarantee that any prediction of T16 and 17
have been performed blindly. Thus, the Management
Committee decided to cancel the two targets.
Sorry about that, and our apologies to all of you who
worked hard on predicting these targets. There are three
more to do in the next two weeks. Good luck with those.
Target 15: T15 ImmD-ColD
From: Marc Graille and Herman van Tilbeurgh (Gif-sur-Yvette)
Complex between the ImmD immunity protein and the
catalytic domain of Colicin D (Marc Graille and
Herman van Tilbeurgh, LEBS-CNRS, Gif-sur-Yvette, France).
Both molecules are taken from the complex; surface
side chains have been shaved to the C-beta, and the
orientation is random.
T15 PDB entry 1V74 has been released
Download
CAPRI5-15
Target 16: A. nidulans xylanase - XIP
From: Alain Roussel (AFMB, Marseille, France)
Target 16 is a complex between the XIP-1 xylanase inhibitor
(PDB entry 1OM0) and A. nidulans xylanase, which is highly
similar to P. simplicissimum xylanase (PDB entry 1BG4), from
which it can be homology-built.
T16 PDB entry 1TA3
has been released
Its sequence is: A. nidulans (xylanase famille 10)
ASLNDLFVAAGKSYFGTCSDQALLQNSQNEAIVASQFGVITPENSMKWDALEPSQGNF
GWSGADYLVDYATQHNKKVRGHTLVWHSQLPSWVSSIGDANTLRSVMTNHINEVVGRY
KGKIMHWDVVNEIFNEDGTFRNSVFYNLLGEDFVRIAFETARAADPDAKLYINDYNLD
SASYAKTQAMASYVKKWLAEGVPIDGIGSQAHYSSSHWSSTEAAGALSSLANTGVSEV
AITELDIAGAASSDYLNLLNACLNEQKCVGITVWGVSDKDSWRASDSPLLFDGNYQPK
DAYNAIVNALS
Download
CAPRI5-16
Target 17: P. funiculosum xylanase - XIP
From: Alain Roussel (AFMB, Marseille, France)
Target 17 is a complex between the XIP-1 xylanase inhibitor
(PDB entry 1OM0) and P. funiculosum xylanase, which is
unrelated to the A. nidulans enzyme of Target 16. It is
related to A.niger xylanase (PDB entry 1UKR), from which
it can be homology-built.
For T17 PDB entry 1TE1has been released.
Its sequence is: P. funiculosum (xylanase famille 11)
ITTSQTGTNNGYYYSFWTNGGGEVTYTNGDNGEYSVTWVDCGDFTSGKGWNPANAQTVTYS
GEFNPSGNAYLAVYGWTTDPLVEYYILESYGTYNPSSGLTSLGQVTSDGGTYDIYSTQRVN
QPSIEGTSTFNQYWSVRTEKRVGGTVTTANHFAAWKALGLEMGTYNYMIVSTEGYESSGSS
TITVS
Download
CAPRI5-17