EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08179 - SspP)
FAM  PF08179
PID  SspP
DES  Small acid-soluble spore protein P family
ANO  4
ALN  47
AID  0.568076
APH  (SSPP_OCEIH/1-47:0.51892,(SSPP_BACHD/1-45:0.35626,SSPP_BACSU/1-45:0.07113):0.34133,Q733L9_BACC1/1-37:0.23135);
ATP  (SSPP_OCEIH/1-47,(SSPP_BACHD/1-45,SSPP_BACSU/1-45),Q733L9_BACC1/1-37);
ATL  1.51899
DNO  4
DLN  141
DID  0.608342
DPH  (SSPP_OCEIH/1-47:0.21591,(SSPP_BACHD/1-45:0.30761,SSPP_BACSU/1-45:0.19320):0.24281,Q733L9_BACC1/1-37:0.22188);
DTP  (SSPP_OCEIH/1-47,(SSPP_BACHD/1-45,SSPP_BACSU/1-45),Q733L9_BACC1/1-37);
DTL  1.18141
RID  0.568076
RPH  (SSPP_OCEIH/1-47:0.51892,(SSPP_BACHD/1-45:0.35626,SSPP_BACSU/1-45:0.07113):0.34133,Q733L9_BACC1/1-37:0.23135);
RTP  (SSPP_OCEIH/1-47,(SSPP_BACHD/1-45,SSPP_BACSU/1-45),Q733L9_BACC1/1-37);
RTL  1.51899
LNK  Q733L9_BACC1/1-37:Q733L9:AE017275
LNK  SSPP_BACHD/1-45:Q9KAI6:AP001515
LNK  SSPP_BACSU/1-45:P71032:U72073
LNK  SSPP_OCEIH/1-47:Q8CUT7:AP004596
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q733L9_BACC1/1-37
ASQ  MS--------KNNREAKEKKGQP--EPLSGSHKVKNRNHSRQKHHAH
DSQ  ATGAGC------------------------AAAAACAATCGTGAAGCGAAAGAAAAAAAAGGACAACCC------GAACCATTAAGCGGATCTCATAAAGTAAAAAACCGTAACCATTCACGCCAAAAACATCATGCACAT
TRN  11111101111011000
NAM  SSPP_OCEIH/1-47
ASQ  MSKRKMGPKQQKNPELPKSPEQPYGEPLSGSKKEKKANHSGQKHNPH
DSQ  ATGTCAAAAAGAAAGATGGGGCCAAAACAACAAAAAAATCCAGAACTGCCAAAAAGTCCCGAACAACCATATGGTGAACCATTAAGCGGATCAAAAAAAGAAAAAAAGGCAAATCATTCAGGACAAAAACATAATCCACAC
TRN  10010101100011000
NAM  SSPP_BACHD/1-45
ASQ  MTERHTAKDIRKNAPKGENPGQP--EPLSGSKKVKKRNHVSQTNGEG
DSQ  ATGACCGAGCGACATACAGCAAAAGACATTCGTAAAAATGCACCGAAAGGCGAGAACCCTGGACAGCCT------GAACCTTTATCAGGGTCAAAAAAAGTGAAAAAGCGAAATCATGTCAGCCAAACAAACGGGGAAGGC
TRN  11111101111011000
NAM  SSPP_BACSU/1-45
ASQ  MTNKNTSKDMHKNAPKGHNPGQP--EPLSGSKKVKNRNHTRQKHNSS
DSQ  ATGACCAATAAGAATACAAGTAAAGATATGCATAAAAACGCCCCTAAAGGACACAATCCCGGCCAACCC------GAGCCTCTAAGCGGAAGCAAAAAAGTAAAAAACCGAAACCATACAAGACAAAAGCACAACTCAAGC
TRN  10010101110011001
//