EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08178 - GnsAB)
FAM  PF08178
PID  GnsAB
DES  GnsA/GnsB family
ANO  4
ALN  57
AID  0.526198
APH  ((Q6MUJ9_MYCMS/454-510:1.63698,Q5PCS1_SALPA/1-54:0.42401):0.00258,GNSB_ECOLI/1-54:0.24119,GNSA_ECOLI/1-54:0.11989);
ATP  ((Q6MUJ9_MYCMS/454-510,Q5PCS1_SALPA/1-54),GNSB_ECOLI/1-54,GNSA_ECOLI/1-54);
ATL  2.4266
DNO  3
DLN  171
DID  0.50823
DPH  (Q6MUJ9_MYCMS/454-510:1.03921,GNSA_ECOLI/1-54:0.16912,Q5PCS1_SALPA/1-54:0.31057);
DTP  (Q6MUJ9_MYCMS/454-510,GNSA_ECOLI/1-54,Q5PCS1_SALPA/1-54);
DTL  1.5189
RID  0.478669
RPH  (Q6MUJ9_MYCMS/454-510:1.66201,GNSA_ECOLI/1-54:0.04695,Q5PCS1_SALPA/1-54:0.47275);
RTP  (Q6MUJ9_MYCMS/454-510,GNSA_ECOLI/1-54,Q5PCS1_SALPA/1-54);
RTL  2.18171
LNK  GNSA_ECOLI/1-54:P52635:D90735
LNK  GNSB_ECOLI/1-54:P77695:
LNK  Q5PCS1_SALPA/1-54:Q5PCS1:CP000026
LNK  Q6MUJ9_MYCMS/454-510:Q6MUJ9:BX842642
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q6MUJ9_MYCMS/454-510
ASQ  MSDEKIKKTFEENIKNFITKKLNELGTPLGKWHVEIKNGILNISAGSSWLASLTAKI
DSQ  ATGTCTGATGAAAAAATTAAGAAAACATTTGAAGAAAACATTAAAAATTTTATTACAAAAAAATTAAATGAATTAGGAACACCATTAGGCAAATGGCATGTAGAAATTAAAAATGGGATACTAAATATTTCTGCTGGTTCTTCATGATTAGCGAGTTTAACAGCTAAAATA
TRN  00010000000000000
NAM  GNSB_ECOLI/1-54
ASQ  MNIENLKTKAEADISEYITKKIIELKKKTGKEVTSIQFTAREKMTG---LESYDVKI
NAM  GNSA_ECOLI/1-54
ASQ  MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTG---LESYDVKI
DSQ  GTGAATATTGAAGAGTTAAAAAAACAAGCCGAAACGGAAATCGCCGACTTTATCGCGCAAAAAATCGCCGAGCTGAACAAGAATACAGGGAAAGAAGTCTCTGAAATTCGCTTCACCGCACGAGAAAAAATGACCGGG---------CTTGAAAGTTATGATGTCAAAATC
TRN  11011101101011010
NAM  Q5PCS1_SALPA/1-54
ASQ  MNSEELTHKAEEEIAALISKKVAELRKKTGQEVSEIEFVPRETMKG---LEGYHVKI
DSQ  ATGAACAGCGAAGAGTTGACACATAAAGCGGAAGAGGAAATCGCGGCACTCATTAGCAAAAAGGTCGCCGAACTACGGAAGAAAACCGGGCAAGAGGTTTCCGAAATAGAGTTCGTGCCGCGAGAAACGATGAAAGGG---------CTTGAGGGATACCACGTTAAAATT
TRN  10010101110011011
//