EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08136 - Ribosomal_S22)
FAM  PF08136
PID  Ribosomal_S22
DES  30S ribosomal protein subunit S22 family
ANO  2
ALN  47
AID  1
APH  (RS22_SALTY/1-47:0.00000,RS22_SALTI/1-47:0.00000);
ATP  (RS22_SALTY/1-47,RS22_SALTI/1-47);
ATL  0
DNO  2
DLN  141
DID  0.985816
DPH  (RS22_SALTY/1-47:0.00000,RS22_SALTI/1-47:0.01440);
DTP  (RS22_SALTY/1-47,RS22_SALTI/1-47);
DTL  0.01439
RID  1
RPH  (RS22_SALTY/1-47:0.00000,RS22_SALTI/1-47:0.00000);
RTP  (RS22_SALTY/1-47,RS22_SALTI/1-47);
RTL  0
LNK  RS22_SALTI/1-47:Q8XFL2:AL627270
LNK  RS22_SALTY/1-47:Q7CQJ0:AE008768
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RS22_SALTY/1-47
ASQ  MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRADSQK
DSQ  ATGAAATCGAACCGTCAGGCTCGTCATATACTTGGACTGGATTACAGAATTTCCAACCAGCGTAAGGTTGTTACTGAAGGCGACACCAGCAGCGTGGTGAATAACCCAACCGGCAGAAAGCGCCGCGCCGACAGCCAAAAG
TRN  10010101100011011
NAM  RS22_SALTI/1-47
ASQ  MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRADSQK
DSQ  ATGAAATCGAACCGTCAGGCTCGTCATATACTTGGACTGGATTACAGAATTTCCAACCAGCGTAAGGTTGTTACTGAAGGCGACACCAGCAGCGTGGTGAATAACCCAACCGGCAGAAAGCGTCGCGCCGATAGCCAAAAG
TRN  10010101100011011
//