EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08129 - Antimicrobial17)
FAM  PF08129
PID  Antimicrobial17
DES  Alpha/beta enterocin family
ANO  2
ALN  57
AID  0.980769
APH  (Q9L9U6_ENTFA/1-57:0.01493,Q8VPA2_ENTFA/1-57:0.00286);
ATP  (Q9L9U6_ENTFA/1-57,Q8VPA2_ENTFA/1-57);
ATL  0.01778
DNO  2
DLN  171
DID  0.994152
DPH  (Q9L9U6_ENTFA/1-57:0.00543,Q8VPA2_ENTFA/1-57:0.00044);
DTP  (Q9L9U6_ENTFA/1-57,Q8VPA2_ENTFA/1-57);
DTL  0.00587
RID  0.980769
RPH  (Q9L9U6_ENTFA/1-57:0.01493,Q8VPA2_ENTFA/1-57:0.00286);
RTP  (Q9L9U6_ENTFA/1-57,Q8VPA2_ENTFA/1-57);
RTL  0.01778
LNK  Q8VPA2_ENTFA/1-57:Q8VPA2:AY063485
LNK  Q9L9U6_ENTFA/1-57:Q9L9U6:AF164559
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9L9U6_ENTFA/1-57
ASQ  MKQYKVLNEKEMKKPIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
DSQ  ATGAAGCAATATAAAGTATTGAATGAAAAAGAAATGAAAAAACCTATTGGGGGAGAGTCGGTTTTTAGTAAAATAGGTAATGCTGTAGGTCCAGCTGCTTATTGGATTTTAAAAGGATTAGGTAATATGAGTGATGTAAACCAAGCTGATAGAATTAATAGAAAGAAACAT
TRN  10010101110011010
NAM  Q8VPA2_ENTFA/1-57
ASQ  MKQYKVLNEKEMKKTIGGESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
DSQ  ATGAAGCAATATAAAGTATTGAATGAAAAAGAAATGAAAAAAACTATTGGGGGAGAGTCGGTTTTTAGTAAAATAGGTAATGCTGTAGGTCCAGCTGCTTATTGGATTTTAAAAGGATTAGGTAATATGAGTGATGTAAACCAAGCTGATAGAATTAATAGAAAGAAACAT
TRN  10010101110011010
//