EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08114 - PMP1_2)
FAM  PF08114
PID  PMP1_2
DES  ATPase proteolipid family
ANO  2
ALN  43
AID  0.975
APH  (PMP1_YEAST/1-40:0.00000,PMP2_YEAST/1-43:0.02570);
ATP  (PMP1_YEAST/1-40,PMP2_YEAST/1-43);
ATL  0.0257
DNO  2
DLN  129
DID  0.916667
DPH  (PMP1_YEAST/1-40:0.08885,PMP2_YEAST/1-43:0.00057);
DTP  (PMP1_YEAST/1-40,PMP2_YEAST/1-43);
DTL  0.08942
RID  0.975
RPH  (PMP1_YEAST/1-40:0.00000,PMP2_YEAST/1-43:0.02570);
RTP  (PMP1_YEAST/1-40,PMP2_YEAST/1-43);
RTL  0.0257
LNK  PMP1_YEAST/1-40:P32903:M77845
LNK  PMP2_YEAST/1-43:P40975:X79370
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PMP1_YEAST/1-40
ASQ  M---TLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF
DSQ  ATG---------ACTTTACCAGGTGGTGTTATTTTAGTTTTCATTTTGGTCGGTTTGGCTTGTATTGCCATTATTGCTACCATTATCTACAGAAAATGGCAAGCTAGACAAAGAGGATTGCAAAGATTC
TRN  10110101110011010
NAM  PMP2_YEAST/1-43
ASQ  MLMSTLPGGVILVFILVGLACIAIISTIIYRKWQARQRGLQRF
DSQ  ATGTTGATGAGCACGTTACCAGGTGGTGTTATCTTAGTTTTTATTCTAGTCGGTTTGGCTTGTATCGCCATCATTTCTACCATTATCTACAGAAAATGGCAAGCTAGACAAAGAGGTTTACAAAGATTC
TRN  10010101110011010
//