EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08107 - Antimicrobial12)
FAM  PF08107
PID  Antimicrobial12
DES  Pleurocidin family
ANO  4
ALN  42
AID  0.59127
APH  ((Q7T054_PSEAM/1-42:0.28725,PLE3_PSEAM/1-42:0.22619):0.29234,Q6JWQ9_EPICO/1-42:0.22599,MORO_MORSA/1-42:0.28770);
ATP  ((Q7T054_PSEAM/1-42,PLE3_PSEAM/1-42),Q6JWQ9_EPICO/1-42,MORO_MORSA/1-42);
ATL  1.31947
DNO  4
DLN  126
DID  0.686508
DPH  (Q7T054_PSEAM/1-42:0.14800,(Q6JWQ9_EPICO/1-42:0.11083,MORO_MORSA/1-42:0.19864):0.23972,PLE3_PSEAM/1-42:0.12784);
DTP  (Q7T054_PSEAM/1-42,(Q6JWQ9_EPICO/1-42,MORO_MORSA/1-42),PLE3_PSEAM/1-42);
DTL  0.82503
RID  0.59127
RPH  ((Q7T054_PSEAM/1-42:0.28725,PLE3_PSEAM/1-42:0.22619):0.29234,Q6JWQ9_EPICO/1-42:0.22599,MORO_MORSA/1-42:0.28770);
RTP  ((Q7T054_PSEAM/1-42,PLE3_PSEAM/1-42),Q6JWQ9_EPICO/1-42,MORO_MORSA/1-42);
RTL  1.31947
LNK  MORO_MORSA/1-42:Q8UUG0:AF385583
LNK  PLE3_PSEAM/1-42:Q90VW7:AF301508
LNK  Q6JWQ9_EPICO/1-42:Q6JWQ9:AY294407
LNK  Q7T054_PSEAM/1-42:Q7T054:AY282498
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PLE3_PSEAM/1-42
ASQ  MKFTATFLVLSLVVLMAEPGECFLGALIKGAIHGGRFIHGMI
DSQ  ATGAAGTTCACTGCCACCTTCCTGGTGCTGTCCCTGGTCGTCCTAATGGCTGAGCCTGGAGAGTGTTTCTTAGGAGCCCTTATCAAAGGGGCCATACATGGTGGCAGGTTTATCCATGGAATGATC
TRN  10010101100011010
NAM  Q7T054_PSEAM/1-42
ASQ  MKLAAAFLVLFLVVLMAEPGESFLGFLFHGIRHGIKAIHGMI
DSQ  ATGAAGTTGGCTGCCGCCTTCCTGGTGCTGTTCCTGGTCGTCCTCATGGCTGAACCTGGAGAGAGTTTTTTGGGATTTCTTTTTCATGGTATCCGCCATGGTATCAAGGCGATCCATGGAATGATC
TRN  11011111101111111
NAM  Q6JWQ9_EPICO/1-42
ASQ  MRCIALFLVLSLVVLMAEPGEGFIFHIIKGLFHAGKMIHGLV
DSQ  ATGAGGTGCATCGCCCTCTTTCTTGTGTTGTCGCTGGTGGTCCTCATGGCTGAACCCGGGGAGGGTTTTATCTTCCACATCATTAAAGGACTCTTTCACGCTGGCAAGATGATCCATGGACTTGTC
TRN  10010101100011011
NAM  MORO_MORSA/1-42
ASQ  MKCATLFLVLSMVVLMAEPGDAFFHHIFRGIVHVGKTIHRLV
DSQ  ATGAAGTGCGCCACGCTCTTTCTTGTGCTGTCGATGGTCGTCCTCATGGCTGAACCTGGGGACGCCTTCTTTCACCACATTTTCCGTGGAATTGTTCACGTCGGCAAGACGATCCACAGACTTGTG
TRN  10010101100011011
//