EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08086 - Toxin_17)
FAM  PF08086
PID  Toxin_17
DES  Ergtoxin family
ANO  4
ALN  41
AID  0.777298
APH  (SEK5_CENNO/1-41:0.19253,(SEK5_CENSC/1-41:0.10091,SEK3_CENGR/1-41:0.13936):0.02097,SEK3_CENEX/1-41:0.22248);
ATP  (SEK5_CENNO/1-41,(SEK5_CENSC/1-41,SEK3_CENGR/1-41),SEK3_CENEX/1-41);
ATL  0.67625
DNO  4
DLN  123
DID  0.845528
DPH  (SEK5_CENNO/1-41:0.05748,(SEK5_CENSC/1-41:0.09336,SEK3_CENGR/1-41:0.08665):0.03828,SEK3_CENEX/1-41:0.07972);
DTP  (SEK5_CENNO/1-41,(SEK5_CENSC/1-41,SEK3_CENGR/1-41),SEK3_CENEX/1-41);
DTL  0.35549
RID  0.777298
RPH  (SEK5_CENNO/1-41:0.19253,(SEK5_CENSC/1-41:0.10091,SEK3_CENGR/1-41:0.13936):0.02097,SEK3_CENEX/1-41:0.22248);
RTP  (SEK5_CENNO/1-41,(SEK5_CENSC/1-41,SEK3_CENGR/1-41),SEK3_CENEX/1-41);
RTL  0.67625
LNK  SEK3_CENEX/1-41:Q86QT9:AY159354
LNK  SEK3_CENGR/1-41:Q86QV1:AY159342
LNK  SEK5_CENNO/1-41:Q86QV7:AY159336
LNK  SEK5_CENSC/1-41:Q86QU2:AY159351
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SEK5_CENNO/1-41
ASQ  DRDSCVDKSKCGKYGYYQECQDCCKNAGHNGGTCVYYKCKC
DSQ  GATAGAGATAGCTGTGTTGATAAATCAAAATGCGGAAAATATGGATACTACCAAGAGTGTCAGGATTGTTGCAAGAATGCTGGACACAATGGAGGAACCTGCGTGTATTACAAGTGTAAATGT
TRN  10110101110011001
NAM  SEK3_CENGR/1-41
ASQ  DRDSCVDKSRCQKYGPYGQCTDCCKKAGHTGGTCIYFKCKC
DSQ  GATAGAGATAGCTGTGTTGATAAATCACGATGCCAAAAATATGGACCCTACGGACAGTGTACGGACTGTTGCAAGAAAGCTGGACACACTGGAGGAACCTGCATATATTTCAAGTGTAAATGT
TRN  10010101110011001
NAM  SEK5_CENSC/1-41
ASQ  DRDSCVDKSRCAKYGYYGQCEVCCKKAGHNGGTCMFFKCMC
DSQ  GATAGAGATAGCTGTGTTGATAAATCACGATGCGCAAAATATGGATACTACGGTCAATGTGAAGTTTGTTGTAAGAAAGCTGGACATAATGGAGGAACCTGTATGTTTTTCAAGTGTATGTGC
TRN  10110101110011001
NAM  SEK3_CENEX/1-41
ASQ  DRDSCVDKSKCAKYGYYYQCDECCKKAGDRAGTCEYFKCKC
DSQ  GATAGAGATAGCTGTGTTGATAAATCAAAATGCGCAAAATATGGATACTACTATCAATGTGATGAATGTTGCAAGAAAGCTGGAGACCGTGCAGGAACCTGCGAGTATTTCAAGTGTAAATGT
TRN  10110101110011001
//