EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08081 - RBM1CTR)
FAM  PF08081
PID  RBM1CTR
DES  RBM1CTR (NUC064) family
ANO  7
ALN  45
AID  0.531269
APH  (((((Q9DAE2_MOUSE/170-214:0.16965,O75526_HUMAN/173-217:0.10186):0.32375,ROG_MOUSE/170-214:0.02348):0.07364,Q6IRQ4_XENLA/148-192:0.20100):0.11573,O97767_MACEU/171-215:0.09984):0.09892,Q6TLG7_BRARE/155-199:0.69777,Q15376_HUMAN/174-218:0.52235);
ATP  (((((Q9DAE2_MOUSE/170-214,O75526_HUMAN/173-217),ROG_MOUSE/170-214),Q6IRQ4_XENLA/148-192),O97767_MACEU/171-215),Q6TLG7_BRARE/155-199,Q15376_HUMAN/174-218);
ATL  2.42799
DNO  7
DLN  135
DID  0.552734
DPH  ((((Q9DAE2_MOUSE/170-214:0.15530,O75526_HUMAN/173-217:0.07852):0.44264,ROG_MOUSE/170-214:0.01259):0.10146,Q6IRQ4_XENLA/148-192:0.20151):0.09470,(Q6TLG7_BRARE/155-199:0.66408,O97767_MACEU/171-215:0.07304):0.05014,Q15376_HUMAN/174-218:0.33962);
DTP  ((((Q9DAE2_MOUSE/170-214,O75526_HUMAN/173-217),ROG_MOUSE/170-214),Q6IRQ4_XENLA/148-192),(Q6TLG7_BRARE/155-199,O97767_MACEU/171-215),Q15376_HUMAN/174-218);
DTL  2.2136
RID  0.531269
RPH  (((((Q9DAE2_MOUSE/170-214:0.16965,O75526_HUMAN/173-217:0.10186):0.32375,ROG_MOUSE/170-214:0.02348):0.07364,Q6IRQ4_XENLA/148-192:0.20100):0.11573,O97767_MACEU/171-215:0.09984):0.09892,Q6TLG7_BRARE/155-199:0.69777,Q15376_HUMAN/174-218:0.52235);
RTP  (((((Q9DAE2_MOUSE/170-214,O75526_HUMAN/173-217),ROG_MOUSE/170-214),Q6IRQ4_XENLA/148-192),O97767_MACEU/171-215),Q6TLG7_BRARE/155-199,Q15376_HUMAN/174-218);
RTL  2.42799
LNK  O75526_HUMAN/173-217:O75526:AF069682
LNK  O97767_MACEU/171-215:O97767:U79565
LNK  Q15376_HUMAN/174-218:Q15376:U36608
LNK  Q6IRQ4_XENLA/148-192:Q6IRQ4:BC070649
LNK  Q6TLG7_BRARE/155-199:Q6TLG7:AY394938
LNK  Q9DAE2_MOUSE/170-214:Q9DAE2:AK005907
LNK  ROG_MOUSE/170-214:O35479:AF031568
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q6IRQ4_XENLA/148-192
ASQ  RSSEMGGRAPLSRERDGYGAPPRRDPMPSRRDVYMSPRDDGYSGK
DSQ  CGAAGCAGTGAAATGGGAGGCAGAGCTCCACTTTCGCGTGAGAGGGATGGTTATGGTGCACCACCCCGCAGAGACCCAATGCCATCTCGAAGAGATGTCTATATGTCCCCTAGAGATGATGGCTACAGTGGAAAA
TRN  10010101110011011
NAM  O97767_MACEU/171-215
ASQ  SSRQMGGRGQLSGGRDSYGGPPRRESLSSRRDVHMSPRDDSYSTK
DSQ  AGCAGTAGACAAATGGGAGGAAGAGGGCAACTGTCTGGTGGAAGAGATAGCTATGGAGGTCCTCCAAGACGAGAATCATTGTCCTCACGCAGAGATGTGCATATGTCACCAAGAGATGACAGTTACAGTACTAAA
TRN  10010101100011001
NAM  ROG_MOUSE/170-214
ASQ  SSSGMGGRTPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTK
DSQ  AGCAGCAGTGGAATGGGCGGAAGAACACCAGTGTCCCGTGGAAGAGATAGCTACGGGGGTCCACCACGAAGGGAACCCCTGCCATCTCGCAGAGATGTTTATTTGTCCCCAAGAGATGATGGATATTCTACAAAA
TRN  10010101100011011
NAM  O75526_HUMAN/173-217
ASQ  SGGGMRGRALAVRGRDGYSGPPRREPLPPRRDPYLGPRDEGYSSR
DSQ  AGCGGCGGTGGAATGCGCGGGAGGGCCCTGGCCGTGCGGGGGCGAGACGGCTACTCAGGCCCACCGCGCCGGGAGCCGCTGCCCCCGCGCCGCGACCCCTACCTGGGCCCGCGGGATGAGGGCTACTCGTCCAGA
TRN  10010101100011001
NAM  Q9DAE2_MOUSE/170-214
ASQ  SGAGIRGRAAGSRGRDGYGGPPRRELPPPRRDPYLGPRDEGYSPR
DSQ  AGCGGCGCGGGAATTCGCGGGCGGGCGGCGGGCTCCCGGGGACGAGACGGCTACGGGGGCCCGCCGCGCCGGGAGCTGCCACCGCCGCGCCGCGACCCGTACCTGGGCCCGCGCGACGAGGGCTACTCGCCCCGG
TRN  11011111101111111
NAM  Q6TLG7_BRARE/155-199
ASQ  RSAPSGPMGRPSRDRDPYGPPPRRDSLMSRRDDGPPHRDDHYGSK
DSQ  AGATCTGCACCTTCTGGGCCAATGGGCAGACCGTCCAGAGACCGGGATCCATATGGCCCCCCTCCACGCAGAGATTCTCTTATGTCACGGCGGGATGATGGTCCTCCACATCGAGATGACCACTATGGTAGTAAA
TRN  10010101110011001
NAM  Q15376_HUMAN/174-218
ASQ  SNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATN
DSQ  AGCAATAGTTGGATGGGAAGCCAAGGTCCCATGTCACAAAGAAGAGAGAATTATGGAGTTCCTCCACGCAGAGCGACAATATCTTCCTGGAGAAATGATCGCATGTCAACAAGACATGATGGTTATGCAACTAAC
TRN  10010101110011001
//