EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08017 - Fibrinogen_BP)
FAM  PF08017
PID  Fibrinogen_BP
DES  Fibrinogen binding protein
ANO  3
ALN  509
AID  0.455529
APH  (Q84EL5_STRAG/1-186:0.21858,Q84EL4_STRAG/1-312:0.07280,Q6BGL7_PARTE/1-500:2.16114);
ATP  (Q84EL5_STRAG/1-186,Q84EL4_STRAG/1-312,Q6BGL7_PARTE/1-500);
ATL  2.45252
DNO  3
DLN  1527
DID  0.532626
DPH  (Q84EL5_STRAG/1-186:0.10466,Q84EL4_STRAG/1-312:0.14775,Q6BGL7_PARTE/1-500:1.19144);
DTP  (Q84EL5_STRAG/1-186,Q84EL4_STRAG/1-312,Q6BGL7_PARTE/1-500);
DTL  1.44385
RID  0.455529
RPH  (Q84EL5_STRAG/1-186:0.21858,Q84EL4_STRAG/1-312:0.07280,Q6BGL7_PARTE/1-500:2.16114);
RTP  (Q84EL5_STRAG/1-186,Q84EL4_STRAG/1-312,Q6BGL7_PARTE/1-500);
RTL  2.45252
LNK  Q6BGL7_PARTE/1-500:Q6BGL7:CR548612
LNK  Q84EL4_STRAG/1-312:Q84EL4:AJ437622
LNK  Q84EL5_STRAG/1-186:Q84EL5:AJ437621
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q84EL5_STRAG/1-186
ASQ  MFNKI--------------------GFRTW-------KSGKLWLYMGVLGSTIILGSSPVSAM--DSVGN-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERR--------------QRDAENKSQVGQLIGKNPLLSKSIISRE---------NNHSSQGDSNKQSFSKKVSQVTNVANRPMLTNNSRTISVINKLPKTGDDQNVIFKLVGFGLILLTSRCGLRRNEN
DSQ  TTGTTCAATAAAATA------------------------------------------------------------GGTTTTAGAACTTGG---------------------AAATCAGGAAAGCTTTGGCTTTATATGGGAGTGCTAGGATCAACTATTATTTTAGGATCAAGTCCTGTATCTGCTATG------GATAGTGTTGGAAAT---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CAAAGTCAGGGCAATGTTTTAGAGCGTCGTCAACGCGATGCAGAAAACAGAAGCCAAGGTAATGTTCTAGAGCGTCGTCAACGCGATGCAGAAAACAGAAGCCAAGGTAATGTTCTAGAGCGTCGT------------------------------------------CAACGTGATGCGGAAAACAAGAGCCAAGTAGGTCAACTTATAGGGAAAAATCCACTTCTTTCAAAGTCAATTATATCTAGAGAA---------------------------AATAATCACTCTAGTCAAGGTGACTCTAACAAACAGTCATTCTCTAAAAAAGTATCTCAGGTTACTAATGTAGCTAATAGACCGATGTTAACTAATAATTCTAGAACAATTTCAGTGATAAATAAATTACCTAAAACAGGTGATGATCAAAATGTCATTTTTAAACTTGTAGGTTTTGGTTTAATTTTGTTAACAAGTCGCTGCGGTTTGAGACGCAATGAAAAT
TRN  10010101110011000
NAM  Q84EL4_STRAG/1-312
ASQ  MFNKI--------------------GFRTW-------KSGKLWLYMGVLGSTIILGSSSVSAM--DSVGN-------QSQGNVLERRQRDAENRSQGNVLERRQRDAE--------NRSQGNVLERRQRDAENRSQGNVLERRQRDVENKSQGNVLERRQRDAENRSQGNVLERRQRDVENK------------SQGNVLERR-------QRD------------------------------AENRSQGNVLERRQRDAENRSQGNVLERRQRDA-------------------------------ENRSQGNVLERRQRDAENKSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERRQRDAENRSQGNVLERR--------------QRDAENKSQGNVLERR---------QRD---------AENRSQG---------------NVLER-------RQRDVENK-----SQGNV-----------LERR---QRDAE
DSQ  TTGTTCAATAAAATA------------------------------------------------------------GGTTTTAGAACTTGG---------------------AAATCAGGAAAGCTTTGGCTTTATATGGGAGTGCTAGGATCAACTATTATTTTAGGATCAAGTTCTGTATCTGCTATG------GATAGTGTTGGAAAT---------------------CAAAGTCAGGGCAATGTTTTAGAGCGTCGTCAACGCGATGCAGAAAACAGAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGTGATGCAGAA------------------------AACAGAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGTGATGCAGAAAACAGAAGCCAAGGTAATGTTCTAGAGCGTCGTCAACGCGATGTTGAAAATAAAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGTGATGCAGAAAACAGAAGCCAAGGTAATGTTCTAGAGCGTCGTCAACGCGATGTTGAAAATAAA------------------------------------AGCCAAGGCAATGTTTTAGAGCGTCGT---------------------CAACGTGAT------------------------------------------------------------------------------------------GCAGAAAACAGAAGCCAAGGTAATGTTCTAGAGCGTCGTCAACGTGATGCAGAAAACAGAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGCGATGCA---------------------------------------------------------------------------------------------GAAAACAGAAGCCAAGGCAATGTTCTAGAGCGTCGTCAACGTGATGCTGAAAACAAAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGTGATGCAGAAAACAGAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGTGATGCTGAAAACAGAAGCCAAGGCAATGTTTTAGAGCGTCGTCAACGCGATGCAGAAAACAGAAGCCAAGGTAATGTTCTAGAGCGTCGT------------------------------------------CAACGTGATGCGGAAAACAAGAGCCAAGGCAATGTTTTAGAGCGTCGT---------------------------CAACGTGAT---------------------------GCAGAAAACAGAAGCCAAGGC---------------------------------------------AATGTTTTAGAGCGT---------------------CGTCAACGCGATGTTGAGAATAAG---------------AGCCAAGGCAATGTT---------------------------------TTAGAGCGTCGT---------CAACGTGATGCGGAA
TRN  10010101110011000
NAM  Q6BGL7_PARTE/1-500
ASQ  MVKQLFTEQEKQDLLKKKAKEIREEFFQTYVPIQNAEESEKKKLMKKVPWNEHMTATSDDKILIDATLGNEEAQREVQIYQITFANVQRSIAYLTQEGVPVQRPDDFEVEMFKSPKQMDKINLKIEKKRDEKNKKEEEKMKKHSKKL--NKQMKIKKMREEHKEKRQNKVAIEQWKKEIKEKGSDKARDLDEIIKQNNQISKKFKKDKNQQQDGIKKNSMFKQKNGKFKKTGKMRTQDNSFQKGENRNFGQRSQSSDGFRNNKFEGKPQNSRSFSAQGGQRNNKQFGGDSHSQERKPFGGRGKSFGGENRSEGNSFRGRGRGSENRSEGNSFRGRGRGGDSRSQGNSFRGRGRGGDNRSQGTSFRGRGRGGDNRSDGNSFRGRGGKSFGGRGKSFGSDNNSEGKSFGGRGRGRGGQFGGQRGGRSFGGRGKSFGNENRSEG----KSFGRGGKFGGQQGGRPFRGKPQGGKSFGGKQHGGNKKGNQSFKSNKSFGKGQSFR---QKGKK
DSQ  ATGGTAAAGTAATTATTCACAGAATAAGAGAAATAAGATCTATTGAAAAAGAAAGCAAAAGAGATAAGAGAGGAGTTTTTTTAAACTTATGTTCCAATATAAAATGCAGAGGAGTCAGAGAAGAAGAAACTGATGAAAAAAGTCCCATGGAATGAACATATGACAGCAACTTCAGATGATAAAATATTAATAGATGCAACTTTGGGAAATGAGGAAGCATAAAGGGAAGTGTAAATTTATCAAATTACCTTTGCAAATGTGTAGAGATCAATAGCATACTTAACATAAGAAGGAGTTCCTGTTCAAAGACCTGATGATTTTGAAGTTGAAATGTTTAAGAGTCCTAAATAAATGGATAAAATCAATCTAAAAATTGAGAAAAAGAGGGATGAAAAAAATAAAAAAGAAGAAGAAAAAATGAAAAAGCATAGTAAAAAATTA------AACAAATAAATGAAAATCAAAAAAATGAGAGAAGAACATAAAGAAAAAAGATAAAACAAGGTTGCCATTGAGTAATGGAAAAAAGAAATCAAAGAAAAAGGAAGTGATAAAGCTAGGGACTTAGATGAAATTATCAAGTAAAATAATTAAATATCAAAAAAATTTAAGAAGGATAAAAACTAATAACAAGATGGTATTAAAAAAAATAGTATGTTTAAATAAAAGAATGGTAAGTTTAAGAAGACAGGCAAGATGAGAACATAAGACAATTCATTCCAAAAAGGGGAAAACAGAAATTTTGGATAAAGATCATAAAGCTCTGATGGATTTAGAAATAATAAGTTTGAAGGAAAACCATAAAATAGTAGAAGTTTCTCAGCTTAAGGTGGCTAAAGAAATAATAAATAATTTGGTGGTGATAGCCATAGTTAAGAAAGAAAACCCTTTGGAGGTAGAGGAAAGTCATTCGGAGGTGAAAATAGATCTGAAGGAAATTCCTTCAGAGGGAGAGGAAGAGGTAGTGAAAACAGATCTGAAGGAAACTCTTTCAGAGGAAGAGGAAGAGGAGGAGATAGTAGATCTTAAGGAAACTCTTTCAGAGGAAGAGGAAGAGGTGGTGATAATAGATCTTAAGGAACTTCTTTCAGAGGAAGAGGAAGAGGAGGTGACAATAGATCCGACGGAAATTCTTTTAGAGGAAGAGGAGGGAAGTCTTTTGGAGGAAGAGGAAAATCATTTGGAAGTGATAATAATTCTGAAGGAAAATCTTTTGGAGGAAGAGGAAGAGGAAGAGGTGGTTAATTCGGCGGACAAAGAGGCGGTAGGTCTTTTGGAGGTAGAGGAAAATCATTCGGAAATGAAAATAGATCTGAAGGA------------AAATCTTTCGGAAGAGGAGGTAAATTTGGGGGACAGCAAGGTGGTAGGCCATTTAGAGGAAAACCATAAGGTGGTAAGTCCTTCGGAGGAAAATAACATGGTGGTAATAAAAAGGGAAATTAGTCATTTAAAAGTAATAAATCTTTTGGAAAAGGACAATCTTTCAGA---------TAAAAAGGAAAAAAA
TRN  00000100000000000
//