EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08003 - Methyltransf_9)
FAM  PF08003
PID  Methyltransf_9
DES  Protein of unknown function (DUF1698)
ANO  11
ALN  326
AID  0.606773
APH  (((((Q7UAC4_SHIFL/1-322:0.12331,Q6D482_ERWCT/1-322:0.18032):0.05148,Q7N556_PHOLL/1-322:0.14411):0.08534,(Q6LT56_PHOPR/1-322:0.18106,(Q7MJ71_VIBVY/1-322:0.11784,Q9KSU3_VIBCH/1-322:0.16171):0.04871):0.15421):0.08370,((Q6AIL0_DESPS/1-318:0.89970,Q87XG5_PSESM/1-318:0.30983):0.19841,Q8EEE6_SHEON/1-322:0.21985):0.07027):0.18593,YECP_HAEIN/1-321:0.08519,Q7VL50_HAEDU/1-320:0.17746);
ATP  (((((Q7UAC4_SHIFL/1-322,Q6D482_ERWCT/1-322),Q7N556_PHOLL/1-322),(Q6LT56_PHOPR/1-322,(Q7MJ71_VIBVY/1-322,Q9KSU3_VIBCH/1-322))),((Q6AIL0_DESPS/1-318,Q87XG5_PSESM/1-318),Q8EEE6_SHEON/1-322)),YECP_HAEIN/1-321,Q7VL50_HAEDU/1-320);
ATL  3.47842
DNO  11
DLN  978
DID  0.586892
DPH  ((((((Q7N556_PHOLL/1-322:0.22888,Q7UAC4_SHIFL/1-322:0.18880):0.04223,Q6D482_ERWCT/1-322:0.21185):0.05813,(Q9KSU3_VIBCH/1-322:0.16717,(Q7MJ71_VIBVY/1-322:0.18483,Q6LT56_PHOPR/1-322:0.26258):0.06183):0.15080):0.04700,(Q6AIL0_DESPS/1-318:0.64520,Q87XG5_PSESM/1-318:0.29119):0.14086):0.05998,Q8EEE6_SHEON/1-322:0.25244):0.19390,YECP_HAEIN/1-321:0.14623,Q7VL50_HAEDU/1-320:0.20279);
DTP  ((((((Q7N556_PHOLL/1-322,Q7UAC4_SHIFL/1-322),Q6D482_ERWCT/1-322),(Q9KSU3_VIBCH/1-322,(Q7MJ71_VIBVY/1-322,Q6LT56_PHOPR/1-322))),(Q6AIL0_DESPS/1-318,Q87XG5_PSESM/1-318)),Q8EEE6_SHEON/1-322),YECP_HAEIN/1-321,Q7VL50_HAEDU/1-320);
DTL  3.53669
RID  0.606773
RPH  (((((Q7UAC4_SHIFL/1-322:0.12331,Q6D482_ERWCT/1-322:0.18032):0.05148,Q7N556_PHOLL/1-322:0.14411):0.08534,(Q6LT56_PHOPR/1-322:0.18106,(Q7MJ71_VIBVY/1-322:0.11784,Q9KSU3_VIBCH/1-322:0.16171):0.04871):0.15421):0.08370,((Q6AIL0_DESPS/1-318:0.89970,Q87XG5_PSESM/1-318:0.30983):0.19841,Q8EEE6_SHEON/1-322:0.21985):0.07027):0.18593,YECP_HAEIN/1-321:0.08519,Q7VL50_HAEDU/1-320:0.17746);
RTP  (((((Q7UAC4_SHIFL/1-322,Q6D482_ERWCT/1-322),Q7N556_PHOLL/1-322),(Q6LT56_PHOPR/1-322,(Q7MJ71_VIBVY/1-322,Q9KSU3_VIBCH/1-322))),((Q6AIL0_DESPS/1-318,Q87XG5_PSESM/1-318),Q8EEE6_SHEON/1-322)),YECP_HAEIN/1-321,Q7VL50_HAEDU/1-320);
RTL  3.47842
LNK  Q6AIL0_DESPS/1-318:Q6AIL0:CR522870
LNK  Q6D482_ERWCT/1-322:Q6D482:BX950851
LNK  Q6LT56_PHOPR/1-322:Q6LT56:CR378666
LNK  Q7MJ71_VIBVY/1-322:Q7MJ71:BA000037
LNK  Q7N556_PHOLL/1-322:Q7N556:BX571866
LNK  Q7UAC4_SHIFL/1-322:Q7UAC4:AE016984
LNK  Q7VL50_HAEDU/1-320:Q7VL50:AE017155
LNK  Q87XG5_PSESM/1-318:Q87XG5:AE016871
LNK  Q8EEE6_SHEON/1-322:Q8EEE6:AE015684
LNK  Q9KSU3_VIBCH/1-322:Q9KSU3:AE004196
LNK  YECP_HAEIN/1-321:P44167:U32814
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7UAC4_SHIFL/1-322
ASQ  MIDFGNFYSLIAK-NHLSHWLETLPAQIANWQREQQHGLFKQWSNTVEFLPEIKPYRLDLLHS.VTAESEEPLSTGQIKR.IETLMRNLMPWRKGPFSLYGVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPA-LKAFDTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVYFIPSALALKNWLKKCGFVDIRIVDVCVTTTEEQRRTEWMVTESLSDFLDPHDPSKTVEGYPAPKRAVLIARK
DSQ  ATGATCGACTTTGGTAACTTTTATTCTCTGATTGCCAAA---AATCATCTTTCACACTGGCTCGAAACGCTGCCCGCGCAGATTGCTAACTGGCAGCGCGAGCAGCAGCACGGGCTGTTTAAGCAGTGGTCCAACACGGTGGAATTTCTGCCTGAAATTAAACCGTATCGTCTGGATTTATTGCATAGC...GTAACCGCCGAAAGCGAAGAGCCACTGAGCACCGGGCAAATTAAACGC...ATTGAAACGCTTATGCGGAACCTGATGCCATGGCGCAAAGGGCCGTTCTCACTGTATGGCGTCAACATCGATACCGAATGGCGTTCCGACTGGAAATGGGATCGTGTTCTGCCCCATCTTTCTGATTTAACCGGACGCACCATTCTGGATGTCGGCTGCGGCAGCGGTTATCACATGTGGCGCATGATTGGCGCAGGCGCGCACCTCGCGGTGGGGATCGACCCTACGCAACTGTTTCTGTGCCAGTTTGAAGCGGTGCGTAAACTACTGGGTAACGATCAGCGCGCACATTTGTTACCGTTAGGTATTGAACAGCTTCCGGCA---CTGAAAGCCTTTGATACCGTCTTTTCGATGGGCGTGCTTTACCATCGCCGTTCGCCGCTGGAGCATCTCTGGCAGTTGAAAGATCAACTGGTGAATGAGGGTGAACTGGTGCTGGAAACGCTGGTTATTGATGGCGATGAGAACACGGTGCTGGTACCAGGCGATCGTTACGCGCAAATGCGTAATGTCTATTTCATCCCTTCCGCGCTGGCGCTGAAAAACTGGCTGAAGAAGTGTGGTTTTGTAGATATCCGCATTGTGGATGTGTGCGTTACCACTACTGAAGAGCAGCGACGCACTGAATGGATGGTTACCGAATCTCTGTCCGATTTCCTCGACCCACATGATCCGAGTAAGACAGTTGAAGGTTATCCTGCGCCTAAACGCGCGGTGCTGATTGCGCGCAAG
TRN  11011101101011000
NAM  Q6D482_ERWCT/1-322
ASQ  MIDFGNFYQQIAK-GPLSHWLNTLPSQLSSWQQESLHGKFKLWFNSLEHLPSLKPTSLDLNDS.VTARIEPDISVGQREG.IEKLLRNLMPWRKGPFSLYGVDINTEWRSDWKWQRVLPHISPLKNRLILDVGCGSGYHLWRMVGEGATMAVGIDPMQLFLCQFEAVRKLLGDDQRAHVLPLGIEQLPE-LAAFDTVFSMGVLYHRRSPLDHLWQLKNQLVAGGELVLETLVIEGDENQVLVPGERYAQMRNVYFIPSAVALTTWLEKCGFVDVRIVDICTTTTQEQRRTDWMITESLAEFLDPEDPTKTVEGYPAPVRAVLVARK
DSQ  GTGATCGATTTCGGCAATTTTTATCAGCAAATCGCAAAG---GGCCCGCTCAGCCACTGGCTTAACACGCTGCCTTCACAGCTCAGCAGTTGGCAGCAAGAATCCCTGCACGGTAAGTTCAAGCTATGGTTTAACTCGCTGGAACACCTCCCGTCGCTGAAGCCAACCTCTTTAGATTTGAACGACAGC...GTCACAGCACGCATCGAGCCCGATATTTCCGTCGGTCAGCGCGAAGGG...ATTGAAAAGCTGCTACGTAATCTGATGCCCTGGCGTAAAGGCCCCTTTTCGCTTTACGGTGTGGATATCAACACCGAATGGCGTTCAGACTGGAAATGGCAGCGCGTTCTACCACATATCAGCCCGCTGAAAAATCGCCTGATTCTGGATGTAGGCTGCGGCAGCGGCTATCACCTATGGCGAATGGTCGGTGAAGGTGCCACGATGGCGGTGGGTATCGACCCCATGCAGCTATTCTTATGTCAGTTTGAAGCCGTGCGTAAGCTACTCGGCGACGACCAGCGCGCACACGTTCTGCCACTCGGCATTGAGCAACTTCCCGAG---CTGGCTGCGTTTGATACCGTATTTTCCATGGGCGTCCTGTACCATCGTCGTTCCCCGCTCGACCACCTGTGGCAGTTGAAAAATCAGCTGGTAGCGGGTGGTGAGCTGGTGCTGGAAACGCTGGTCATTGAAGGTGATGAAAATCAGGTGCTGGTGCCGGGAGAACGCTACGCGCAAATGCGCAATGTGTATTTCATCCCGTCTGCTGTGGCTTTGACAACATGGCTTGAAAAATGCGGATTCGTCGATGTCCGCATCGTCGATATCTGCACAACCACAACACAGGAACAGCGCCGGACAGACTGGATGATCACTGAATCGCTGGCTGAATTCCTCGACCCTGAGGATCCAACGAAAACGGTGGAAGGTTATCCCGCACCGGTACGAGCGGTATTGGTTGCACGTAAA
TRN  11011101101011000
NAM  Q7N556_PHOLL/1-322
ASQ  MIDFGNFYQLIAK-NNLQHWLNCLPAQLQEWQKAALHGNFKSWVKTLENLPEISPTQLDLKNG.VIAERDPPLSAGEKIC.LTNILRIFMPWRKGPFSLYGINIDTEWRSDWKWDRVLPHISPLTGRTILDVGCGSGYHLWRMVGEGAELAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLGIEQLPA-LAAFDTVFSMGVLYHRRSPLDHLWQLKNQLISDGELILESLVVEGDEHTCLIPGERYAQMRNVYFIPSAKMVKIWLEKCGFVDVKIVDQAVTATEEQRRTDWMKTESLSDFLDPTDSNKTIEGYPAPLRAILIARK
DSQ  ATGATCGATTTCGGTAATTTTTATCAACTTATTGCAAAA---AATAACCTCCAGCATTGGCTTAATTGCCTTCCTGCTCAACTGCAAGAGTGGCAAAAAGCAGCCCTGCACGGTAATTTTAAATCATGGGTAAAAACCCTGGAAAACCTACCCGAAATTTCACCGACTCAATTAGACTTGAAAAATGGC...GTGATCGCAGAACGCGATCCGCCCCTATCCGCAGGTGAAAAAATTTGC...CTTACCAATATATTGCGAATATTCATGCCGTGGCGCAAAGGCCCATTCTCGCTTTATGGTATAAATATTGATACTGAATGGCGTTCAGATTGGAAGTGGGATCGAGTACTGCCCCATATTTCTCCATTAACCGGCCGGACAATTCTTGATGTTGGCTGTGGCAGTGGCTATCACCTGTGGCGGATGGTCGGTGAAGGGGCTGAACTTGCCGTTGGTATCGATCCAACTCAGCTCTTCCTCTGCCAATTTGAAGCTGTCAGAAAGTTACTTGGCAATGATCAACGCGCCCATCTTTTACCTCTGGGCATTGAACAATTACCGGCA---CTGGCCGCTTTCGATACAGTCTTTTCAATGGGAGTTCTCTATCACCGCCGCTCTCCTCTTGACCATCTCTGGCAATTGAAAAACCAGCTTATATCCGATGGTGAACTGATATTGGAAAGTCTGGTTGTTGAAGGAGATGAACATACCTGTTTAATCCCAGGTGAACGTTATGCTCAAATGCGCAACGTCTACTTCATTCCTTCGGCAAAAATGGTGAAAATCTGGCTAGAGAAGTGCGGTTTTGTCGATGTGAAAATTGTCGATCAGGCAGTCACAGCCACGGAAGAACAACGTCGTACAGATTGGATGAAAACTGAATCACTATCTGATTTCCTCGATCCTACAGATAGCAATAAAACCATTGAGGGTTATCCCGCCCCTCTACGGGCGATACTGATCGCCCGTAAG
TRN  10010101100011000
NAM  Q9KSU3_VIBCH/1-322
ASQ  MFNFANVYQQIAQHPQLQLWLNTLPQQLTDWQ-AKQHGDLDRWMRNLKKIPVGQPEVIDLKNA.VAAHNHQPLAQGEQKK.LEAVLKTFHPWRKGPYHLHGIHIDTEWRSDWKWDRLLPHISPLKNRLVLDVGCGNGYHMWRMLGEGAQQVFGIDPSELFLIQFEAVRKLLGDDQRVHLLPLGIEQMPE-LNAFDTVFSMGVLYHRRSPLDHLLQLKNQLVAGGELILETLVVEGDEHTVLVPFDRYAQMRNVYFFPSALALKVWLEKTGFVDVRIVDENITSLGEQRTTEWMTHNSLPDYVDPQDPSKTIEGYPAPRRAILIAKK
DSQ  ATGTTCAACTTTGCCAACGTTTACCAACAGATCGCTCAACATCCGCAGTTACAGTTGTGGCTCAACACCCTGCCTCAGCAATTGACGGATTGGCAA---GCTAAGCAGCACGGAGATCTCGATCGCTGGATGCGTAACCTCAAGAAAATTCCGGTCGGTCAACCGGAGGTGATTGATCTGAAAAATGCG...GTAGCGGCACACAATCATCAGCCACTCGCGCAAGGTGAACAGAAGAAA...TTGGAAGCGGTGCTCAAAACCTTTCACCCTTGGCGTAAAGGTCCTTACCATCTGCACGGCATTCATATTGATACCGAATGGCGATCCGATTGGAAATGGGATCGCTTACTGCCACACATCTCGCCACTGAAAAACCGTTTGGTACTTGATGTGGGTTGTGGCAACGGCTATCACATGTGGCGCATGCTGGGTGAAGGGGCGCAGCAAGTGTTCGGCATTGACCCTTCCGAGCTGTTTCTGATCCAGTTTGAAGCGGTACGTAAACTGCTGGGCGATGACCAACGCGTTCATCTCTTGCCACTCGGTATTGAACAGATGCCGGAG---CTCAACGCCTTTGATACTGTGTTCAGCATGGGCGTGCTTTACCACCGTCGCTCACCACTCGATCACCTGCTGCAACTGAAAAATCAGTTGGTTGCTGGCGGTGAATTGATCCTGGAAACCTTAGTCGTAGAAGGGGATGAACATACGGTACTGGTGCCGTTTGATCGCTACGCCCAAATGCGCAACGTCTATTTCTTCCCTTCTGCACTGGCTCTTAAAGTGTGGTTAGAAAAGACAGGGTTTGTCGATGTGCGTATTGTCGATGAAAATATCACTTCACTCGGTGAGCAGCGTACCACAGAGTGGATGACACACAATTCACTGCCCGATTACGTTGACCCACAAGACCCAAGCAAGACCATTGAAGGCTATCCGGCGCCGCGACGTGCCATTCTGATTGCCAAAAAG
TRN  11011101101011000
NAM  Q7MJ71_VIBVY/1-322
ASQ  MFNFANFYQLIAQDTRLQPWLNVLPQQLTDWQ-NAEHGDFPRWLKALNKIPEGAPDQIDIKHS.VTISNDTPFHQGELKK.LESLLRTFHPWRKGPYTVHGIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGARLCVGIDPSHLFLIQFEAIRKLMGGDQRAHLLPLGIEQLPK-LEAFDTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELILETLVIEGDETAVLVPKERYAQMRNVYFFPSARALKVWLELVGFEDVRIVDENVTSVDEQRTTNWMTHNSLPDYLDQNDPSKTVEGYPAPRRAILVAKK
DSQ  ATGTTTAATTTTGCTAATTTTTACCAGTTAATCGCTCAAGACACTCGTCTTCAGCCATGGCTCAACGTTCTACCTCAACAGCTAACAGATTGGCAA---AATGCTGAGCATGGTGATTTCCCTCGCTGGTTAAAAGCACTCAATAAGATCCCAGAAGGCGCACCCGATCAGATAGACATTAAGCACTCT...GTCACCATTAGCAATGACACCCCGTTCCATCAAGGCGAGTTGAAGAAG...CTTGAAAGCTTGCTGCGTACTTTCCACCCTTGGCGCAAAGGCCCTTATACCGTTCACGGCATTCATATTGACACCGAATGGCGCAGTGACTGGAAATGGGACCGTGTTCTACCTCATATTTCACCATTGAAAAATCGCAGCGTGCTGGATGTCGGCTGTGGCAATGGTTATCACATGTGGCGCATGTTGGGTGAAGGCGCACGTCTGTGCGTGGGTATTGATCCATCACACCTGTTTTTAATTCAGTTTGAAGCGATCCGTAAGTTAATGGGTGGCGATCAACGTGCACACCTGCTGCCATTGGGCATTGAACAGCTACCAAAG---CTTGAAGCGTTCGATACTGTTTTCAGTATGGGGGTGTTGTACCACCGTCGCTCTCCGCTTGATCACTTAATTCAACTGAAAGATCAGCTTGTCTCCGGCGGTGAATTGATTCTGGAAACCTTGGTGATTGAAGGGGATGAAACGGCAGTTTTGGTTCCCAAGGAACGCTACGCTCAAATGCGCAATGTGTATTTCTTCCCTTCAGCTCGCGCTTTAAAAGTGTGGTTAGAATTGGTTGGCTTTGAAGACGTGCGCATCGTGGACGAAAACGTCACCTCTGTCGACGAGCAACGCACCACCAATTGGATGACTCACAATTCACTGCCTGATTATCTCGATCAGAATGACCCGAGCAAAACGGTGGAAGGTTATCCAGCACCTCGCCGCGCAATTTTGGTGGCGAAAAAG
TRN  10010101100011000
NAM  Q6LT56_PHOPR/1-322
ASQ  MFSFSEFYKLIAQHETLRPWLNTLPKQLSDWE-EAEHGDMGRWIRALKKFPTDKPDIIDIKNE.VSVRYEDGIANGEQKR.LESLLRLLHPWRKGPYNMHGIHIDTEWRSDWKWDRVLPHISPLQGRSVLDVGCGNGYHMWRMLGEGAALTVGIDPSNLFLIQFEAIRRLMGDDNRAFLLPLGIEQLPE-LKAFDTVFSMGVLYHRRSPLDHIIQLKNQLRKDGEVILETLVIEGDENAVLVPTGRYAQMHNVYFFPSAKALKVWMEKCGFVDVRIVDESVTTTDEQRSTDWMTNNSLPEYLSPDDPTKTIEGYPAPKRAILVARN
DSQ  ATGTTTAGTTTTTCTGAGTTTTATAAGCTAATCGCCCAGCACGAAACCCTTCGTCCTTGGCTAAATACCTTACCAAAGCAATTAAGTGATTGGGAA---GAAGCAGAGCACGGCGACATGGGTCGTTGGATCCGCGCATTGAAAAAATTCCCCACAGATAAGCCTGATATCATCGATATCAAAAACGAA...GTAAGTGTTCGTTATGAAGATGGTATTGCTAACGGTGAACAAAAACGT...TTAGAAAGCTTGTTACGTTTATTGCACCCATGGCGTAAAGGCCCGTACAACATGCACGGTATTCACATTGATACTGAATGGCGCTCAGATTGGAAGTGGGATCGCGTATTACCGCATATCTCACCACTGCAAGGTCGTTCAGTATTAGATGTCGGTTGTGGTAACGGCTACCACATGTGGCGTATGTTAGGTGAAGGGGCGGCATTAACCGTCGGAATTGACCCATCAAACCTCTTCTTAATCCAATTTGAAGCAATACGTCGCTTAATGGGTGATGATAACCGCGCGTTTTTATTACCTTTAGGTATTGAACAACTGCCAGAG---TTAAAGGCATTCGATACCGTTTTCAGCATGGGCGTACTTTATCACCGCCGTTCGCCATTAGATCATATCATTCAATTAAAGAACCAACTTCGTAAAGATGGTGAAGTGATTCTTGAAACCTTAGTGATTGAAGGTGACGAAAACGCAGTATTAGTGCCAACAGGCCGTTACGCGCAAATGCACAATGTATACTTTTTCCCATCAGCAAAAGCGTTAAAAGTCTGGATGGAAAAATGCGGCTTTGTTGATGTTCGCATTGTTGATGAAAGCGTCACAACAACCGATGAGCAACGGTCGACAGATTGGATGACGAATAATTCCTTACCGGAATATTTAAGCCCAGATGATCCAACAAAAACCATTGAGGGTTACCCTGCACCTAAGCGCGCTATTTTAGTTGCTCGGAAT
TRN  10010101100011000
NAM  Q8EEE6_SHEON/1-322
ASQ  MINFSSFYQQIAD-SNLQHWLETLPAILGKWQREHKHGNLPKWEKVLNKLHYPSPDSVDLVDS.VTIGTGEQLTPGEKEK.LENLLRLFMPWRKGPFHIHGIHIDTEWRSDWKWDRVKPHISPLQNRTVLDVGCGSGYHMWRMLGAGAKRVVGIDPSPLFLCQFEAVKRLSGENHPVHLLPLGIEELPP-LDAFDTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDRYGKMNNVWFIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPNESLVEYLDPKDITKTVEGYPAPKRATIIAVK
DSQ  GTGATTAATTTCAGTTCCTTTTATCAACAAATCGCCGAT---TCCAATTTACAGCATTGGCTTGAAACCTTGCCAGCTATCCTTGGCAAATGGCAAAGAGAACATAAACACGGCAACTTACCCAAATGGGAAAAAGTGCTTAATAAACTGCACTATCCTAGTCCTGACAGTGTCGATTTGGTTGATAGT...GTCACTATAGGCACAGGCGAACAACTTACGCCCGGTGAAAAGGAAAAA...CTCGAGAATTTACTGCGACTCTTTATGCCTTGGCGTAAAGGTCCATTCCATATTCACGGCATTCATATCGATACCGAATGGCGCAGTGATTGGAAATGGGATCGGGTTAAACCGCATATTTCACCACTACAGAATCGCACTGTGCTCGATGTGGGTTGCGGTAGCGGCTATCACATGTGGCGTATGTTAGGTGCCGGTGCTAAGCGTGTTGTAGGTATCGACCCTTCCCCACTGTTTTTATGCCAATTTGAAGCAGTAAAACGCTTAAGTGGTGAAAATCATCCTGTACACCTGTTACCACTTGGCATTGAAGAGCTGCCCCCA---TTAGATGCCTTTGATACCGTATTCTCCATGGGCGTCTTGTATCACAGACGTTCACCCATTGATCATCTGTTGCAATTACGCGATCAGTTACGCATGGGTGGAGAATTAGTGCTAGAGACATTAGTCATTGATGGTGATGAAAACGCGGTACTCGTCCCGCAAGATAGATATGGCAAAATGAATAACGTTTGGTTTATTCCATCCGTCGCGGCACTGATGCTCTGGCTTAAAAAGTGTGATTTCACCGATATACGTTGTGTCGATACCGATGTCACCGCCCTTGCTGAGCAGCGCCGAACCGATTGGATGCCAAATGAATCACTGGTTGAATATCTTGACCCTAAAGATATCACGAAGACGGTTGAGGGGTATCCGGCGCCCAAACGTGCAACGATCATTGCAGTGAAA
TRN  10010101100011000
NAM  Q7VL50_HAEDU/1-320
ASQ  MIDFRPFYQQIAT-SHLSAWLETLPLQLKQWE-KTAHSDYAKWAKIATSMPT-SPTSINLTDK.VEAVLAEALPEGEKQY.LIYRLKQLMPWRKGPYHLHGVHIDTEWRSDFKWQRVLPHLAPLKDRTILDVGCGNGYHMWRMVGEDAQMVVGIDPTELFLCQFEAVRQLLGNDRRANLIPLGLEQMQP-LAAFDTVFSMGVLYHRKSPLDHLSQLKAQLVKGGELVLETLIIDGDINDILTPADRYAKMKNVYFIPSVAALINWLKKIGFKNARCVDQSVTTLAEQRKTEWLENESLVDFLDPTDQRKTIEGLPAPKRAVILANA
DSQ  ATGATCGACTTTCGCCCTTTTTATCAACAAATTGCAACT---TCACATCTTTCTGCTTGGTTGGAAACACTGCCTTTACAATTGAAGCAATGGGAA---AAAACCGCGCATAGTGATTATGCTAAATGGGCAAAAATTGCAACATCTATGCCGACT---TCCCCCACGTCTATTAATCTAACAGACAAA...GTAGAAGCTGTGTTAGCAGAAGCACTTCCAGAAGGTGAAAAGCAATAT...TTAATTTATCGTTTAAAACAATTAATGCCTTGGCGTAAAGGTCCTTATCATTTACATGGTGTTCATATAGATACAGAATGGCGGTCAGATTTTAAATGGCAGCGCGTATTACCGCATTTAGCCCCCTTGAAAGATCGCACCATTTTAGATGTAGGCTGTGGTAACGGCTATCATATGTGGCGTATGGTTGGCGAAGACGCCCAAATGGTAGTCGGCATTGATCCAACTGAACTGTTTCTTTGCCAATTTGAGGCGGTTCGCCAATTACTTGGCAATGACCGTCGCGCTAACTTAATTCCACTTGGTCTTGAACAAATGCAACCG---CTTGCTGCTTTTGATACTGTTTTCTCTATGGGGGTGTTATATCATCGAAAATCACCGCTTGATCATCTTTCACAGCTCAAAGCACAATTAGTTAAAGGTGGCGAATTAGTTCTTGAAACCTTAATTATTGATGGCGATATTAATGATATTCTTACCCCCGCCGATCGCTATGCTAAAATGAAAAATGTTTATTTCATTCCCTCAGTTGCCGCATTGATTAATTGGCTAAAGAAAATCGGTTTTAAAAATGCGCGTTGTGTAGATCAATCCGTAACCACTTTAGCGGAACAACGCAAAACTGAGTGGTTAGAAAATGAAAGCTTAGTTGATTTTTTAGATCCAACAGATCAGCGTAAAACAATCGAAGGATTGCCTGCACCAAAACGTGCCGTTATCCTCGCTAATGCC
TRN  10010101100011000
NAM  YECP_HAEIN/1-321
ASQ  MIDFRPFYQQIAT-TNLSDWLETLPCQLKEWE-TQTHGDYAKWSKIVDFLPNLHADEIDLKSA.VKSDRTSPLSEGEKQR.IIHHLKQLMPWRKGPYHLFGIHVDCEWRSDFKWDRVLPHLSPLQGRTILDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEAVRKLLNNDRRANLIPLGIEQMQP-LAAFDTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDINTVLVPADRYAKMKNVYFIPSVATLINWLEKVGFTNVRCVDVATTTLEEQRKTDWLENESLIDFLDPNDHSKTIEGYQAPKRAVILANK
DSQ  ATGATCGACTTTCGCCCTTTTTATCAACAAATTGCTACT---ACAAATTTATCAGACTGGTTAGAGACCTTACCGTGCCAATTGAAAGAATGGGAA---ACTCAAACTCATGGCGATTATGCGAAATGGAGCAAAATTGTTGATTTTCTACCTAATTTGCATGCTGATGAAATCGATCTCAAAAGTGCG...GTGAAATCTGACCGCACTTCTCCCCTTTCAGAAGGTGAAAAACAACGA...ATTATCCATCATTTAAAACAATTAATGCCGTGGCGAAAAGGGCCTTATCATCTTTTCGGCATTCATGTAGATTGTGAATGGCGTTCAGATTTTAAATGGGATCGTGTTCTTCCTCACTTGTCGCCCTTGCAAGGTCGCACTATTTTAGATGTGGGCTGTGGCAGCGGTTATCATATGTGGAGAATGGTAGGCGAAGGCGCAAAAATGGTGGTCGGGATTGATCCTACCGAGCTTTTCCTTTGCCAATTTGAAGCCGTACGCAAACTGCTTAATAATGATCGTCGAGCAAATCTTATCCCGCTAGGTATTGAGCAAATGCAACCA---TTAGCGGCATTTGACACTGTATTTTCAATGGGCGTACTCTATCATCGTAAATCCCCATTAGATCATTTAAGCCAGTTGAAAAATCAATTGGTAAAAGGTGGCGAATTGGTATTAGAAACGTTAGTAGTGGATGGCGATATAAATACTGTGCTCGTACCAGCAGATCGCTATGCGAAAATGAAAAATGTTTATTTTATCCCCTCTGTCGCCACACTAATTAACTGGCTAGAAAAAGTTGGCTTTACCAACGTACGTTGTGTTGATGTAGCGACAACTACATTAGAAGAACAGCGTAAAACTGATTGGTTGGAAAATGAAAGCCTGATTGATTTTTTAGATCCAAATGATCACAGTAAAACCATTGAAGGTTATCAAGCACCGAAAAGAGCGGTAATTTTAGCAAATAAA
TRN  10010101100011000
NAM  Q87XG5_PSESM/1-318
ASQ  MIDLAPLVRRLAG-TPLAEWANGLQAQLDTKM-SKGHGDLQRWQSALDALPALQPEKVDLTDS.FTLETE---CDGETRTvLRKALLGLSPWRKGPFNVFGVHIDTEWRSDWKWSRVSPHL-DLKGKRVLDVGCGNGYYQWRMLGAGADSVIGVDPNWLFFCQFQAMQRYL-PDLPAWHLPFALEDLPANLEGFDTVFSMGVLYHRKSPIDHLLALKDCLVKGGELVMETLVIPGDVHQVLVPEDRYAQMRNVWFLPSVPALELWMRRAGFTDVRCVDVSHTTVEEQRSTEWMRFQSLGDYLDPNDHSKTVEGLPAPMRAVIVGRK
DSQ  ATGATTGATCTCGCACCTCTTGTCCGTCGTCTGGCGGGC---ACCCCTCTGGCTGAATGGGCCAATGGCCTGCAAGCACAACTCGACACCAAGATG---AGCAAAGGCCACGGCGATCTGCAACGCTGGCAAAGCGCGCTGGACGCCCTGCCGGCCCTGCAACCCGAGAAGGTCGATCTGACTGACAGC...TTTACTCTGGAAACCGAG---------TGCGACGGCGAAACCCGTACTgtaCTGCGCAAGGCGTTGCTCGGTTTATCGCCGTGGCGCAAGGGGCCGTTCAATGTGTTCGGTGTGCACATCGACACCGAATGGCGCTCGGACTGGAAGTGGTCACGGGTGTCACCGCACCTC---GACTTGAAGGGCAAGCGTGTTCTGGATGTGGGCTGCGGCAATGGCTATTACCAGTGGCGCATGCTCGGTGCCGGGGCGGACAGCGTGATTGGTGTGGACCCCAACTGGCTGTTCTTCTGCCAGTTCCAGGCCATGCAACGCTACCTG---CCCGACCTGCCCGCCTGGCACCTGCCGTTCGCACTTGAAGACTTGCCCGCCAACCTGGAAGGTTTCGACACGGTATTTTCCATGGGCGTGCTGTATCACCGCAAATCGCCCATTGACCATTTGCTGGCGTTGAAAGACTGCCTGGTCAAAGGGGGCGAGCTGGTGATGGAAACGCTGGTGATTCCTGGCGATGTGCATCAGGTGCTGGTGCCGGAAGACCGTTATGCGCAAATGCGCAACGTGTGGTTCCTGCCCTCAGTGCCGGCGCTGGAGCTATGGATGCGCCGCGCAGGCTTCACCGATGTGCGCTGTGTTGATGTGAGCCACACGACGGTCGAAGAACAGCGCAGCACCGAGTGGATGCGCTTTCAGTCACTGGGCGACTACCTGGACCCTAACGATCACAGCAAGACGGTCGAAGGACTGCCAGCGCCAATGCGTGCGGTGATTGTGGGGCGTAAA
TRN  11011101101011000
NAM  Q6AIL0_DESPS/1-318
ASQ  M----KYLKHLSD-AADREAIKALHDERQTWV-NQEKKGFLRYREPYLQLARFKADSINLENDvVTIGHGEQISHEEQAE.IRQALRAYMPWRKGPFAVFGVDIDAEWRSERKWQRLEKHLPDLKGKVIADIGCNNGYYMFRMAAQEPAFVLGIEPSVQHYYCFKALEEMSGLTNLEIDL-LGVEHLPLFTESFDVVFLMGIIYHRSAPIETLRAVLDSLKPGGTLILETQGIPGEQPYALFPDKTYAKVPGTYFVPSASCLINWMHKAGFIDVDLFCDHPMSPEEQRQTEWMEFESYKDFLDPENPELTLEGYPAPHRFFVKATK
DSQ  ATG------------AAATACCTAAAACACCTCTCGGAT---GCAGCCGACAGAGAGGCCATAAAAGCACTTCACGATGAACGCCAGACCTGGGTC---AACCAAGAGAAGAAGGGCTTTCTCCGCTACCGTGAACCCTACCTGCAACTGGCCAGGTTCAAGGCCGACTCCATCAATCTCGAAAACGACgttGTGACCATCGGCCACGGCGAACAGATCAGCCACGAGGAGCAGGCAGAA...ATCCGTCAGGCTCTACGAGCATATATGCCCTGGCGCAAGGGTCCCTTCGCGGTCTTTGGTGTCGATATCGATGCAGAGTGGCGAAGCGAAAGAAAATGGCAGAGACTGGAGAAGCATCTCCCAGACCTCAAGGGCAAGGTCATTGCCGATATCGGCTGCAATAATGGCTACTATATGTTTCGTATGGCAGCCCAGGAACCAGCATTTGTCCTCGGCATCGAACCATCGGTGCAACACTACTACTGCTTTAAGGCCCTGGAAGAGATGTCGGGCCTGACCAACCTTGAGATTGATCTC---CTCGGGGTTGAACACCTGCCCCTCTTCACTGAGTCCTTCGATGTCGTCTTTCTCATGGGAATCATCTACCACAGATCAGCACCCATAGAGACCCTGCGGGCCGTACTGGACTCACTAAAGCCGGGCGGCACCCTCATTCTGGAAACCCAGGGTATCCCGGGCGAGCAACCCTACGCCCTCTTCCCCGACAAGACCTACGCCAAGGTACCGGGCACCTACTTTGTCCCCAGTGCAAGTTGTCTGATTAACTGGATGCACAAGGCCGGTTTCATAGACGTTGACCTCTTCTGCGATCACCCCATGTCCCCCGAAGAACAACGACAGACCGAATGGATGGAATTTGAATCCTATAAGGATTTCCTCGATCCAGAAAACCCGGAACTAACCCTTGAAGGTTATCCCGCCCCCCACCGTTTCTTTGTCAAAGCCACAAAG
TRN  10010101100011001
//