EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF08000 - DUF1696)
FAM  PF08000
PID  DUF1696
DES  Protein of unknown function (DUF1696)
ANO  16
ALN  123
AID  0.482085
APH  (((((((((Q81PU7_BACAN/3-124:0.00828,Q6HI26_BACHK/3-124:0.00000):0.05318,Q813J1_BACCR/3-124:0.03380):0.30584,(Q832M1_ENTFA/3-125:0.17252,(Q8E634_STRA3/3-125:0.00000,Q8E0G0_STRA5/3-125:0.00000):0.22890):0.12587):0.04904,O34593_BACSU/3-125:0.24244):0.08289,(Q6LHY1_PHOPR/3-124:0.41025,Q8EAU5_SHEON/3-124:0.35653):0.09961):0.06578,(Q898N1_CLOTE/15-136:0.10228,Q8ELK9_OCEIH/3-124:0.23178):0.09681):0.57653,Q6NJL6_CORDI/1-120:0.81756):0.35819,(Q6ANG9_DESPS/4-124:0.22328,Q87FW9_VIBPA/22-142:0.14717):0.32147):0.30244,Q8KQ26_9LACT/4-124:0.14695,Q8LTS8_9CAUD/4-124:0.08823);
ATP  (((((((((Q81PU7_BACAN/3-124,Q6HI26_BACHK/3-124),Q813J1_BACCR/3-124),(Q832M1_ENTFA/3-125,(Q8E634_STRA3/3-125,Q8E0G0_STRA5/3-125))),O34593_BACSU/3-125),(Q6LHY1_PHOPR/3-124,Q8EAU5_SHEON/3-124)),(Q898N1_CLOTE/15-136,Q8ELK9_OCEIH/3-124)),Q6NJL6_CORDI/1-120),(Q6ANG9_DESPS/4-124,Q87FW9_VIBPA/22-142)),Q8KQ26_9LACT/4-124,Q8LTS8_9CAUD/4-124);
ATL  5.67838
DNO  16
DLN  369
DID  0.536141
DPH  (((((((Q898N1_CLOTE/15-136:0.16962,Q8ELK9_OCEIH/3-124:0.24507):0.12750,((Q832M1_ENTFA/3-125:0.18784,(Q8E634_STRA3/3-125:0.00000,Q8E0G0_STRA5/3-125:0.00000):0.25235):0.09914,(Q6LHY1_PHOPR/3-124:0.34153,Q8EAU5_SHEON/3-124:0.32730):0.10049):0.05829):0.07879,((Q81PU7_BACAN/3-124:0.00278,Q6HI26_BACHK/3-124:0.00000):0.06609,Q813J1_BACCR/3-124:0.05398):0.23636):0.14434,O34593_BACSU/3-125:0.16283):0.44321,(Q8KQ26_9LACT/4-124:0.18930,Q8LTS8_9CAUD/4-124:0.12065):0.23683):0.09467,Q6NJL6_CORDI/1-120:0.60103):0.19754,Q6ANG9_DESPS/4-124:0.28750,Q87FW9_VIBPA/22-142:0.23834);
DTP  (((((((Q898N1_CLOTE/15-136,Q8ELK9_OCEIH/3-124),((Q832M1_ENTFA/3-125,(Q8E634_STRA3/3-125,Q8E0G0_STRA5/3-125)),(Q6LHY1_PHOPR/3-124,Q8EAU5_SHEON/3-124))),((Q81PU7_BACAN/3-124,Q6HI26_BACHK/3-124),Q813J1_BACCR/3-124)),O34593_BACSU/3-125),(Q8KQ26_9LACT/4-124,Q8LTS8_9CAUD/4-124)),Q6NJL6_CORDI/1-120),Q6ANG9_DESPS/4-124,Q87FW9_VIBPA/22-142);
DTL  5.06343
RID  0.482085
RPH  (((((((((Q81PU7_BACAN/3-124:0.00828,Q6HI26_BACHK/3-124:0.00000):0.05318,Q813J1_BACCR/3-124:0.03380):0.30584,(Q832M1_ENTFA/3-125:0.17252,(Q8E634_STRA3/3-125:0.00000,Q8E0G0_STRA5/3-125:0.00000):0.22890):0.12587):0.04904,O34593_BACSU/3-125:0.24244):0.08289,(Q6LHY1_PHOPR/3-124:0.41025,Q8EAU5_SHEON/3-124:0.35653):0.09961):0.06578,(Q898N1_CLOTE/15-136:0.10228,Q8ELK9_OCEIH/3-124:0.23178):0.09681):0.57653,Q6NJL6_CORDI/1-120:0.81756):0.35819,(Q6ANG9_DESPS/4-124:0.22328,Q87FW9_VIBPA/22-142:0.14717):0.32147):0.30244,Q8KQ26_9LACT/4-124:0.14695,Q8LTS8_9CAUD/4-124:0.08823);
RTP  (((((((((Q81PU7_BACAN/3-124,Q6HI26_BACHK/3-124),Q813J1_BACCR/3-124),(Q832M1_ENTFA/3-125,(Q8E634_STRA3/3-125,Q8E0G0_STRA5/3-125))),O34593_BACSU/3-125),(Q6LHY1_PHOPR/3-124,Q8EAU5_SHEON/3-124)),(Q898N1_CLOTE/15-136,Q8ELK9_OCEIH/3-124)),Q6NJL6_CORDI/1-120),(Q6ANG9_DESPS/4-124,Q87FW9_VIBPA/22-142)),Q8KQ26_9LACT/4-124,Q8LTS8_9CAUD/4-124);
RTL  5.67838
LNK  O34593_BACSU/3-125:O34593:Z99110
LNK  Q6ANG9_DESPS/4-124:Q6ANG9:CR522870
LNK  Q6HI26_BACHK/3-124:Q6HI26:AE017355
LNK  Q6LHY1_PHOPR/3-124:Q6LHY1:CR378678
LNK  Q6NJL6_CORDI/1-120:Q6NJL6:BX248355
LNK  Q813J1_BACCR/3-124:Q813J1:AE017006
LNK  Q81PU7_BACAN/3-124:Q81PU7:AE017032
LNK  Q832M1_ENTFA/3-125:Q832M1:AE016953
LNK  Q87FW9_VIBPA/22-142:Q87FW9:BA000032
LNK  Q898N1_CLOTE/15-136:Q898N1:AE015937
LNK  Q8E0G0_STRA5/3-125:Q8E0G0:AE014227
LNK  Q8E634_STRA3/3-125:Q8E634:AL766847
LNK  Q8EAU5_SHEON/3-124:Q8EAU5:AE015813
LNK  Q8ELK9_OCEIH/3-124:Q8ELK9:BA000028
LNK  Q8KQ26_9LACT/4-124:Q8KQ26:AY112731
LNK  Q8LTS8_9CAUD/4-124:Q8LTS8:AF349457
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8LTS8_9CAUD/4-124
ASQ  FNNASFIKLKPTNDDAFVNNISPIFVKGESILGTYKGIRDGVVFTTHRIIAINVQGITGKKKDFTSLPYSKIQTFSIETAGTFDLDSELELWFSSLGK--VKLEFSSRANVSEIAKIISERIL
DSQ  TTTAACAATGCTTCTTTTATTAAATTAAAACCTACAAATGATGATGCTTTCGTTAATAATATCTCACCGATTTTTGTAAAAGGCGAGTCTATCCTAGGAACATATAAAGGGATACGTGATGGAGTCGTATTTACAACTCATCGTATTATCGCTATTAATGTCCAAGGTATTACTGGTAAGAAAAAAGATTTCACATCTCTTCCTTATTCTAAAATTCAAACTTTCTCTATTGAAACAGCTGGTACTTTTGACTTAGACAGCGAATTGGAATTATGGTTCTCGAGTTTGGGAAAA------GTAAAATTAGAATTCTCAAGTCGTGCAAATGTGTCTGAAATTGCAAAAATTATATCTGAAAGAATTTTA
TRN  10010101110011000
NAM  Q8KQ26_9LACT/4-124
ASQ  FNNSAFVKLKPTSNDVFQDMISAILTDKESLISTYKGMRDGVVFTTHRIIAINVQGITGKKKDFTSLPYSKIQAFSIETAGTFDLDSELELWFSGLGK--VKLEFVSQANVSEIAKIISNKIL
DSQ  TTTAACAACTCGGCTTTTGTAAAATTAAAGCCAACAAGTAACGATGTATTTCAGGACATGATTTCAGCTATTTTAACTGATAAAGAGTCATTGATCAGCACCTACAAAGGAATGCGAGATGGTGTTGTATTTACAACTCATAGAATTATCGCAATCAATGTTCAAGGCATCACAGGAAAGAAAAAAGATTTTACTTCTTTACCATATTCTAAAATCCAAGCGTTCTCTATAGAAACAGCTGGAACATTTGATCTAGATAGCGAATTAGAATTGTGGTTTTCTGGATTAGGAAAA------GTAAAATTAGAATTCGTCAGTCAAGCAAACGTTTCAGAAATTGCAAAAATTATTTCTAATAAAATTTTA
TRN  10010101110011000
NAM  Q87FW9_VIBPA/22-142
ASQ  FDNSSVFKLKPIDVSKVRDDFHKFLIDGETIFTAFKTVRDQVVFTNKRVIAANVQGITGSKVDYTSLPYSKINAFSIETSGTFDLDCEIEFFLSEVGR--VRFEIKGSFDLVAFNRMISERVL
DSQ  TTCGACAACTCATCTGTGTTCAAGCTTAAGCCTATTGACGTTTCCAAAGTCAGAGATGATTTCCACAAATTTTTGATTGATGGTGAGACCATTTTCACCGCTTTTAAAACCGTTCGTGATCAAGTGGTGTTTACCAACAAACGAGTGATTGCGGCGAATGTGCAAGGGATTACGGGCTCAAAAGTGGATTACACGTCGCTGCCTTACAGCAAGATCAATGCATTCTCTATTGAGACTTCCGGCACGTTTGATCTCGATTGCGAAATTGAGTTTTTCTTAAGTGAAGTGGGACGA------GTTCGGTTTGAAATTAAAGGCTCATTTGACCTCGTTGCGTTCAATCGTATGATCAGTGAACGCGTGCTT
TRN  10010101100011000
NAM  Q6ANG9_DESPS/4-124
ASQ  FDKSELFKLKPIDNSKALEAISLFLIDGEKIFATFKTIRDQVVFTNKRIIAANVQGLTGSKVDYTSIPYAKIQTFSVETSGSLDLDCEIEIYISAVGR--VAFEIRGSFDIVGFNRLISQHIL
DSQ  TTTGACAAGTCAGAACTTTTTAAGCTCAAGCCCATTGATAACAGCAAGGCCCTGGAGGCAATATCTCTCTTTCTCATCGACGGGGAGAAGATATTTGCCACCTTTAAGACCATCAGGGATCAGGTAGTTTTCACCAATAAACGAATCATTGCCGCAAATGTGCAGGGACTGACAGGCTCCAAGGTAGACTACACCTCAATTCCCTACGCTAAAATCCAGACCTTTTCCGTGGAAACATCGGGAAGTCTTGATCTTGACTGTGAAATAGAGATCTATATCAGCGCAGTTGGCAGA------GTTGCCTTTGAGATACGAGGGAGCTTTGATATTGTCGGCTTCAACAGGCTGATAAGCCAACACATTCTC
TRN  10010101100011001
NAM  Q8ELK9_OCEIH/3-124
ASQ  LFDGIMGNASEVDNGKIEEEFQQVLAESENIERTYKLIRDLFIFTNKRLILVDKQGVTGKKMEIHSIPYKNIVHFSIETAGSFDLDAELKIWISGNSVP-FQKQFNKSLNIYEVQTVLASYVL
DSQ  CTTTTTGATGGTATTATGGGAAATGCATCCGAAGTAGATAACGGGAAGATTGAAGAAGAATTTCAGCAAGTTTTAGCGGAATCAGAAAATATTGAGAGAACGTATAAACTTATTCGCGATTTATTTATCTTTACGAATAAGCGATTAATTCTAGTAGATAAACAAGGTGTAACAGGTAAAAAGATGGAAATTCATTCGATACCTTACAAAAATATCGTTCACTTTAGTATTGAAACAGCGGGAAGTTTTGATTTAGATGCGGAACTAAAAATCTGGATATCTGGTAATTCTGTGCCT---TTCCAAAAGCAGTTTAACAAAAGCTTAAATATCTATGAAGTTCAAACTGTATTGGCGAGCTACGTACTT
TRN  10010101110011000
NAM  Q898N1_CLOTE/15-136
ASQ  IFDGLMGNASEVNSEQVKKEYAHILAPNEKIEKSYKLIRDMFIFTNKRLILVDKQGVTGKKTEYHSIPYRAITHFSIETVGHFDLDAELKIWISGSSTP-VEKQFNKSLNIYELQSVLAEYVL
DSQ  ATTTTTGATGGATTAATGGGAAATGCCTCAGAAGTGAACTCAGAACAAGTAAAAAAAGAATACGCACATATTTTAGCTCCAAATGAAAAAATAGAAAAGTCATATAAGCTCATAAGAGATATGTTTATATTTACTAATAAAAGATTAATATTAGTGGATAAACAGGGTGTAACAGGTAAAAAAACAGAATATCACTCAATTCCTTATAGAGCAATAACTCATTTTAGCATAGAAACAGTTGGACATTTTGATTTAGATGCAGAGTTAAAGATATGGATTTCAGGTAGTTCCACACCA---GTAGAAAAACAATTTAATAAAAGTTTAAATATATATGAATTGCAAAGTGTACTAGCTGAATATGTATTA
TRN  10010101110011000
NAM  Q8E0G0_STRA5/3-125
ASQ  IFSGLMGNASQMDTDKVENQLSDILISDEQVDLAYTLIRDLIVFTNYRLILVDKQGVTGKKVSYNSIPYASISRFTVETSGHFDLDAELKIWISSAIEPAEVLQFKNDRNIVSIQKALATAVL
DSQ  ATTTTTTCGGGATTAATGGGAAATGCTTCACAAATGGATACCGATAAAGTCGAGAATCAGTTATCTGATATTCTGATTTCAGATGAACAGGTTGATTTAGCTTATACCTTAATTCGTGATTTGATTGTTTTTACTAATTATCGTTTAATTTTAGTCGATAAACAGGGGGTGACAGGTAAAAAGGTTTCTTATAATTCTATACCTTATGCTTCTATATCACGTTTTACAGTGGAAACTAGTGGTCATTTTGATTTAGATGCTGAGTTAAAGATTTGGATATCATCAGCAATAGAACCAGCAGAAGTACTTCAGTTTAAGAACGACCGTAACATAGTGAGTATACAGAAAGCTTTGGCGACAGCTGTTTTA
TRN  10010101100011000
NAM  Q8E634_STRA3/3-125
ASQ  IFSGLMGNASQMDTDKVENQLSDILISDEQVDLAYTLIRDLIVFTNYRLILVDKQGVTGKKVSYNSIPYASISRFTVETSGHFDLDAELKIWISSAIEPAEVLQFKNDRNIVSIQKALATAVL
DSQ  ATTTTTTCGGGATTAATGGGAAATGCTTCACAAATGGATACCGATAAAGTCGAGAATCAGTTATCTGATATTCTGATTTCAGATGAACAGGTTGATTTAGCTTATACCTTAATTCGTGATTTGATTGTTTTTACTAATTATCGTTTAATTTTAGTCGATAAACAGGGGGTGACAGGTAAAAAGGTTTCTTATAATTCTATACCTTATGCTTCTATATCACGTTTTACAGTGGAAACTAGTGGTCATTTTGATTTAGATGCTGAGTTAAAGATTTGGATATCATCAGCAATAGAACCAGCAGAAGTACTTCAGTTTAAGAACGACCGTAACATAGTGAGTATACAGAAAGCTTTGGCGACAGCTGTTTTA
TRN  10010101100011000
NAM  Q832M1_ENTFA/3-125
ASQ  LFDGLLGNATQNNNETAEKELRDVLIPNEKVDMAFTLVRDLIVFTDKRLILVDKQGITGKKVDYKSIPYKSISRFSVETSGHFDLDAELKIWISSTELPSVSLQFRKDKDIVAIQQALAAAVL
DSQ  TTATTTGATGGATTATTAGGAAATGCAACACAAAATAATAATGAAACAGCTGAAAAAGAATTACGGGATGTTTTAATCCCTAACGAAAAAGTAGATATGGCCTTCACTTTAGTAAGAGATTTAATTGTCTTTACAGATAAACGCTTAATTTTAGTCGATAAACAAGGAATTACAGGTAAAAAAGTTGATTATAAATCGATTCCCTACAAATCTATTTCACGCTTTTCTGTTGAAACTAGTGGACATTTCGACCTAGATGCAGAACTAAAGATATGGATTTCAAGTACTGAGTTACCTTCAGTAAGTCTTCAATTTAGAAAAGATAAAGATATTGTTGCTATTCAACAAGCTTTAGCAGCTGCTGTATTA
TRN  10010101110011000
NAM  O34593_BACSU/3-125
ASQ  FIDGLLGNASTLSTAAVQEELAHILLEGEKVEAAFKLVRDLIVFTDKRLILVDKQGITGKKTEFQSIPYKSISRFSVETAGRFDLDSELKIWISGAELPAVSKQFKKDESIYDIQKVLAAVCM
DSQ  TTTATTGATGGATTACTCGGCAATGCATCAACACTGTCAACGGCAGCTGTGCAAGAAGAGCTTGCCCATATTTTACTTGAGGGTGAGAAGGTTGAAGCCGCGTTTAAGCTGGTTCGCGATTTGATTGTCTTTACTGACAAGCGGCTTATCCTTGTAGATAAACAGGGAATTACAGGCAAGAAAACGGAATTTCAATCGATTCCGTACAAAAGCATTTCCAGATTCAGCGTGGAAACTGCCGGCCGCTTTGACCTTGATTCAGAGCTGAAAATTTGGATCTCCGGCGCGGAACTTCCCGCTGTCTCAAAGCAGTTTAAAAAAGATGAAAGCATTTATGATATTCAAAAGGTGCTTGCCGCAGTTTGTATG
TRN  10010101100011000
NAM  Q813J1_BACCR/3-124
ASQ  LFSGILGNASNTSSESVERDLEKIMLDDEKVEHAYKLIRDLIVFTNRRLILVDKQGVTGKKTEYHSIPYKSITQYSIETAGHFDLDAELKIWVSSMEDP-ITKEFKGDDSILSIQKALVTFTT
DSQ  TTATTTAGCGGTATTTTAGGAAATGCATCAAATACGAGTTCTGAAAGTGTAGAACGTGATTTAGAGAAGATTATGCTAGACGATGAAAAAGTAGAGCATGCTTATAAATTAATTCGTGATCTAATCGTATTTACAAATCGTCGTCTTATTTTAGTAGATAAACAAGGAGTAACTGGCAAAAAAACAGAATACCATTCTATTCCTTATAAAAGTATTACACAATATAGCATCGAAACGGCTGGGCATTTTGATTTAGATGCAGAACTTAAAATTTGGGTGTCTAGTATGGAGGATCCA---ATTACGAAAGAATTTAAAGGTGACGATAGTATTTTAAGCATTCAAAAAGCGTTAGTAACCTTTACGACT
TRN  11011101111011000
NAM  Q6HI26_BACHK/3-124
ASQ  LFSGILGNASNASTESVERDLEKIMLDDEKVEHAYKLIRDLIVFTNRRLILVDKQGISGKKTEYHSIPYKSITQFSIETAGHFDLDAELKIWVSSLSTP-ITKEFKGDDSVLSIQKALVTYTT
DSQ  TTATTTAGCGGTATTTTAGGAAATGCATCAAATGCGAGTACAGAAAGTGTAGAACGTGATTTAGAGAAGATTATGTTAGATGACGAGAAAGTAGAACATGCTTATAAATTAATTCGTGATTTAATTGTATTCACAAATCGTCGTCTTATTTTAGTGGATAAACAAGGGATATCAGGTAAAAAAACAGAATACCATTCTATCCCTTATAAAAGCATTACACAATTCAGTATTGAAACAGCTGGGCATTTTGATTTAGACGCTGAACTGAAAATTTGGGTATCTAGTTTGAGCACGCCA---ATTACGAAAGAATTTAAAGGTGACGATAGTGTTTTAAGCATTCAAAAAGCGTTGGTAACATATACGACG
TRN  10010101100011000
NAM  Q81PU7_BACAN/3-124
ASQ  LFSGILGNASNASTESVERDLEKIMLDDEKVEHAYKLIRDLIVFTNRRLILVDKQGISGKKTEYHSIPYKSITQFSIETAGHFDLDAELKIWVSSLSTP-IAKEFKGDDSVLSIQKALVTYTT
DSQ  TTATTTAGCGGTATTTTAGGAAATGCATCAAATGCGAGTACAGAAAGTGTAGAACGTGATTTAGAGAAGATTATGTTAGATGACGAGAAAGTAGAACATGCTTATAAATTAATTCGTGATTTAATTGTATTCACAAATCGTCGTCTTATTTTAGTGGATAAACAAGGGATATCAGGTAAAAAAACAGAATACCATTCTATCCCTTATAAAAGCATTACACAATTCAGTATTGAAACAGCTGGGCATTTTGATTTAGACGCTGAACTGAAAATTTGGGTATCTAGTTTGAGCACGCCA---ATTGCGAAAGAATTTAAAGGTGACGATAGTGTTTTAAGCATTCAAAAAGCGTTGGTAACATATACGACG
TRN  10010101100011000
NAM  Q8EAU5_SHEON/3-124
ASQ  LLDGLLGNASEVNLQELAEELRPIMGIQEELKLAYKVIRDLFVFTNKRLILIDKQGLTGKKTTYHSVPYKSITHFAVETTGHFDMDAELKIWISGQSEP-LVKELKRGTDVVGIQKTIATFAL
DSQ  CTATTAGATGGGCTGCTCGGGAATGCTTCTGAGGTGAATTTACAGGAGCTGGCAGAAGAGTTACGCCCAATAATGGGCATTCAGGAAGAATTAAAACTGGCCTATAAAGTGATCCGTGATCTGTTTGTATTTACCAATAAGCGATTGATCTTAATTGATAAGCAAGGGCTGACTGGCAAGAAAACCACCTATCACTCTGTACCCTATAAATCCATTACCCATTTTGCCGTGGAAACCACAGGTCATTTCGATATGGATGCCGAACTTAAAATTTGGATTTCAGGCCAAAGCGAACCG---CTGGTAAAAGAACTCAAGCGCGGCACCGATGTGGTAGGGATCCAAAAGACTATCGCCACTTTCGCTCTG
TRN  10010101100011000
NAM  Q6LHY1_PHOPR/3-124
ASQ  LFDAILGNAGEMSIADATEELSTILGPNEHIEIAYKLVRDMIVLTDQRLLLIDKQGLTGKKVEYRSIPYKAITMYTVESTGHFDLDAELKVWVSGQSEP-ISLEFNGKTNIYAMQGVLTAKIA
DSQ  CTATTTGACGCTATTTTAGGTAATGCTGGTGAAATGAGCATCGCAGATGCAACAGAAGAGCTTTCTACCATTCTAGGGCCTAACGAACACATAGAGATCGCATACAAATTAGTTCGCGATATGATTGTGTTAACCGACCAGCGTTTACTGCTTATCGACAAACAAGGATTAACTGGGAAAAAAGTTGAATATCGCTCGATTCCTTATAAAGCGATCACCATGTATACCGTTGAGTCTACTGGCCACTTCGATTTAGATGCAGAATTAAAAGTATGGGTTTCAGGGCAATCAGAGCCC---ATTAGCCTTGAGTTTAATGGCAAAACCAATATCTACGCGATGCAAGGTGTACTCACAGCTAAAATCGCA
TRN  10010101100011000
NAM  Q6NJL6_CORDI/1-120
ASQ  METASITEWTFVQEVPIPEDVANLMVPGEDAVVAFKTFRDSAIFTTKRLIVRDSQGLRGKKVEVYSLPYSSVNMWSTENAGTFDFNAEVELWTRAGK---IKIKIGRDLDVRRLDMLLAQCIL
DSQ  ATGGAAACAGCCAGCATTACAGAATGGACTTTCGTCCAAGAAGTACCCATCCCAGAAGACGTTGCCAACCTCATGGTGCCAGGCGAAGATGCCGTCGTTGCGTTTAAAACCTTCCGCGACAGCGCCATCTTTACCACCAAACGCCTCATTGTTCGCGACTCCCAAGGCCTACGAGGCAAGAAGGTAGAGGTCTACTCCTTGCCTTATTCTTCAGTGAATATGTGGTCAACAGAAAATGCCGGCACCTTTGATTTCAACGCCGAAGTGGAGTTGTGGACGCGTGCCGGCAAA---------ATCAAGATCAAAATCGGCCGAGATCTCGACGTACGACGCCTCGACATGCTTCTTGCTCAGTGCATCTTG
TRN  11011101111011001
//