EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07988 - Wos2)
FAM  PF07988
PID  Wos2
DES  Mitotic protein Wos2
ANO  2
ALN  91
AID  0.785714
APH  (Q61928_MOUSE/180-270:0.14147,MYB_CHICK/223-313:0.10694);
ATP  (Q61928_MOUSE/180-270,MYB_CHICK/223-313);
ATL  0.24841
DNO  2
DLN  273
DID  0.747253
DPH  (Q61928_MOUSE/180-270:0.21091,MYB_CHICK/223-313:0.10687);
DTP  (Q61928_MOUSE/180-270,MYB_CHICK/223-313);
DTL  0.31777
RID  0.785714
RPH  (Q61928_MOUSE/180-270:0.18683,MYB_CHICK/223-313:0.06157);
RTP  (Q61928_MOUSE/180-270,MYB_CHICK/223-313);
RTL  0.24841
LNK  MYB_CHICK/223-313:P01103:M14129
LNK  Q61928_MOUSE/180-270:Q61928:M13138
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q61928_MOUSE/180-270
ASQ  FGHASPPSQLSPSGQSSVNSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQ
DSQ  TTTGGGCATGCCTCACCTCCATCTCAGCTCTCTCCAAGTGGCCAGTCCTCCGTCAACAGCGAATATCCCTATTACCACATCGCCGAAGCACAAAACATCTCCAGTCACGTTCCCTATCCTGTCGCATTGCATGTTAATATAGTCAACGTCCCTCAGCCGGCTGCGGCAGCCATCCAGAGACACTATAACGACGAAGACCCTGAGAAGGAAAAGCGAATAAAGGAGCTGGAGTTGCTCCTGATGTCAACAGAGAACGAGCTGAAGGGACAGCAG
TRN  10010101100011001
NAM  MYB_CHICK/223-313
ASQ  FAHNPPAGPLPGAGQAPLGSDYPYYHIAEPQNVPGQIPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQ
DSQ  TTTGCCCACAACCCACCTGCAGGCCCGCTCCCGGGGGCCGGCCAGGCCCCGCTGGGCAGTGACTACCCCTACTACCACATTGCTGAGCCACAAAATGTCCCTGGTCAGATCCCATATCCAGTAGCACTGCATGTAAATATTGTCAATGTTCCTCAGCCAGCTGCTGCAGCTATTCAGAGACACTATAATGATGAAGACCCTGAGAAAGAAAAACGAATAAAGGAATTAGAGTTGCTACTTATGTCGACTGAGAATGAACTGAAAGGGCAGCAG
TRN  10010101100011010
//