EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07967 - zf-C3HC)
FAM  PF07967
PID  zf-C3HC
DES  C3HC zinc finger-like
ANO  5
ALN  122
AID  0.395488
APH  (Q9SHI0_ARATH/84-205:0.37597,Q6ZLP6_ORYSA/90-209:0.15365,((Q8CI56_MOUSE/60-180:0.14281,Q6P7H4_XENLA/66-186:0.24355):1.23666,Q9M997_ARATH/96-216:0.44012):0.16488);
ATP  (Q9SHI0_ARATH/84-205,Q6ZLP6_ORYSA/90-209,((Q8CI56_MOUSE/60-180,Q6P7H4_XENLA/66-186),Q9M997_ARATH/96-216));
ATL  2.75764
DNO  5
DLN  366
DID  0.49093
DPH  (Q9SHI0_ARATH/84-205:0.10576,(Q9M997_ARATH/96-216:0.49334,Q6ZLP6_ORYSA/90-209:0.21161):0.16210,(Q8CI56_MOUSE/60-180:0.15590,Q6P7H4_XENLA/66-186:0.24048):0.77781);
DTP  (Q9SHI0_ARATH/84-205,(Q9M997_ARATH/96-216,Q6ZLP6_ORYSA/90-209),(Q8CI56_MOUSE/60-180,Q6P7H4_XENLA/66-186));
DTL  2.147
RID  0.395488
RPH  (Q9SHI0_ARATH/84-205:0.37597,Q6ZLP6_ORYSA/90-209:0.15365,((Q8CI56_MOUSE/60-180:0.14281,Q6P7H4_XENLA/66-186:0.24355):1.23666,Q9M997_ARATH/96-216:0.44012):0.16488);
RTP  (Q9SHI0_ARATH/84-205,Q6ZLP6_ORYSA/90-209,((Q8CI56_MOUSE/60-180,Q6P7H4_XENLA/66-186),Q9M997_ARATH/96-216));
RTL  2.75764
LNK  Q6P7H4_XENLA/66-186:Q6P7H4:BC061669
LNK  Q6ZLP6_ORYSA/90-209:Q6ZLP6:AP003703
LNK  Q8CI56_MOUSE/60-180:Q8CI56:BC037445
LNK  Q9M997_ARATH/96-216:Q9M997:AC016041
LNK  Q9SHI0_ARATH/84-205:Q9SHI0:AC007651
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9SHI0_ARATH/84-205
ASQ  WDRGDLLRRLATFKPSNWLGKPKTASSLACAQKGWVSVDLDKLQCEYCGSILQYSPPQDSLNPPEADTTGEKFSKQLDDAHESSCPWVGKSCSESLVQFPPTPPSALIGGYKDRCDGLLQFY
DSQ  TGGGATAGAGGAGATTTACTTCGACGTCTTGCCACTTTCAAGCCTTCAAATTGGCTTGGGAAGCCCAAAACAGCTAGTTCTTTGGCTTGTGCTCAGAAAGGCTGGGTTAGTGTTGATCTGGACAAACTTCAATGTGAATACTGTGGGTCCATTCTACAATACTCCCCTCCACAAGATTCGTTGAATCCTCCCGAAGCTGATACCACCGGAGAAAAATTCTCTAAGCAGCTTGATGATGCACATGAGAGCTCTTGTCCTTGGGTAGGAAAAAGTTGTTCAGAAAGCTTAGTTCAGTTTCCTCCAACTCCTCCATCAGCCTTGATTGGAGGTTACAAGGATCGTTGTGATGGGCTCCTACAATTCTAT
TRN  10010101100011000
NAM  Q6ZLP6_ORYSA/90-209
ASQ  WERGDLLRRLATFKSSTWASKPKAASSLACARRGWVNIEMDKIACESCGAHLIFT-ALTSWSPAEVANAGEAFAEQLDASHLGDCPWRGNSCADSLVQFHLT-PSALVGGFKDRCDGLLQFI
DSQ  TGGGAACGAGGAGACTTGCTTCGGCGACTGGCCACATTCAAGTCTTCAACATGGGCTTCTAAGCCAAAGGCTGCTAGTTCACTGGCTTGTGCTCGAAGAGGCTGGGTGAACATTGAAATGGACAAAATTGCATGCGAGTCATGTGGAGCACATCTTATATTTACG---GCATTGACATCTTGGTCCCCAGCTGAAGTTGCTAATGCTGGGGAAGCCTTTGCGGAACAACTTGATGCATCGCACCTGGGTGATTGTCCCTGGAGAGGAAATAGCTGTGCTGATAGCCTAGTCCAATTCCACCTTACC---CCATCAGCTCTTGTTGGTGGTTTCAAAGATCGCTGTGATGGACTTTTGCAGTTTATA
TRN  10010101100011001
NAM  Q9M997_ARATH/96-216
ASQ  WDRGDLMRRLATFKSMTWFAKPQVISAVNCARRGWVNDDADSIACESCGAHLYFS-APSSWSKQQVEKAASVFSLKLESGHKLLCPWIENSCEETLSEFPLMAPQDLVDRHEERSEALLQLL
DSQ  TGGGATAGAGGAGATCTTATGAGGAGGCTTGCTACTTTCAAGTCCATGACTTGGTTTGCCAAGCCACAGGTTATTAGTGCTGTAAATTGTGCGAGGAGAGGGTGGGTGAATGATGACGCAGATTCTATAGCTTGTGAATCTTGTGGAGCTCATCTTTACTTTTCA---GCCCCATCTTCTTGGTCTAAGCAACAAGTGGAAAAAGCGGCATCAGTCTTCAGCTTAAAGTTAGAGAGTGGACACAAATTACTTTGTCCATGGATAGAGAATTCATGTGAAGAAACGCTTTCTGAGTTTCCGTTAATGGCACCGCAGGATTTAGTCGATAGACACGAAGAACGGTCAGAAGCTTTACTTCAACTTTTG
TRN  10010101110011000
NAM  Q6P7H4_XENLA/66-186
ASQ  TSKDAFFSRVESFSSLKWAGKPPELCPLICAKYGWCNIECDMLKCSSCNAYLCAS-LQPILDFSKYKQRCVELQEALRKAHEKFCFWPDSPCPEHFWALLVTEPSSVLSDFVERFHNLCHLE
DSQ  ACCAGTAAAGATGCCTTCTTTAGCAGAGTGGAATCATTCTCCTCCTTGAAGTGGGCTGGTAAACCCCCTGAATTGTGTCCTCTAATTTGTGCCAAGTATGGATGGTGCAATATAGAATGTGATATGTTAAAGTGTTCAAGTTGTAATGCCTACCTCTGTGCCAGC---CTTCAACCAATACTGGATTTCAGCAAGTATAAGCAACGTTGTGTGGAGCTGCAGGAAGCATTGAGAAAAGCGCACGAAAAGTTCTGTTTTTGGCCAGACAGCCCATGTCCAGAGCATTTCTGGGCTCTCCTGGTTACAGAGCCATCCTCCGTATTAAGTGATTTTGTGGAGCGTTTTCACAACCTTTGTCACCTAGAG
TRN  10010101100011000
NAM  Q8CI56_MOUSE/60-180
ASQ  TSKEAFFHRVETFSSLKWAGKPPELSPLICAKYGWVTVECDMLKCSSCQAFLCAS-LQPTFDFGRYKERCAELKKSLCSAHEKFCFWPDSPSPDRFGMLPLGEPAVLISEFLDRFQSLCHLD
DSQ  ACAAGCAAAGAAGCCTTCTTTCACAGAGTGGAAACCTTTTCTTCTTTGAAGTGGGCAGGGAAGCCCCCTGAGCTGTCTCCACTTATCTGCGCTAAATATGGTTGGGTCACAGTTGAATGTGACATGCTCAAGTGCTCCAGCTGCCAGGCTTTCCTCTGTGCCAGC---CTGCAGCCCACGTTTGACTTTGGCAGATATAAGGAGCGATGTGCTGAGCTCAAGAAATCCTTGTGCAGTGCCCATGAGAAGTTCTGTTTTTGGCCAGACAGCCCCTCTCCAGATAGATTTGGGATGTTGCCATTGGGTGAGCCTGCTGTTCTCATCAGTGAGTTCCTGGACCGGTTTCAAAGCCTTTGCCATTTGGAC
TRN  10010101100011011
//