EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07932 - DAP_C)
FAM  PF07932
PID  DAP_C
DES  D-aminopeptidase, domain C
ANO  2
ALN  97
AID  0.835052
APH  (Q9ZBA9_OCHAN/422-518:0.15079,Q8YD27_BRUME/422-518:0.03622);
ATP  (Q9ZBA9_OCHAN/422-518,Q8YD27_BRUME/422-518);
ATL  0.18701
DNO  2
DLN  291
DID  0.745704
DPH  (Q9ZBA9_OCHAN/422-518:0.00000,Q8YD27_BRUME/422-518:0.31538);
DTP  (Q9ZBA9_OCHAN/422-518,Q8YD27_BRUME/422-518);
DTL  0.31537
RID  0.835052
RPH  (Q9ZBA9_OCHAN/422-518:0.17046,Q8YD27_BRUME/422-518:0.01656);
RTP  (Q9ZBA9_OCHAN/422-518,Q8YD27_BRUME/422-518);
RTL  0.18702
LNK  Q8YD27_BRUME/422-518:Q8YD27:AE009672
LNK  Q9ZBA9_OCHAN/422-518:Q9ZBA9:M84523
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZBA9_OCHAN/422-518
ASQ  AKHDIIGRYHSDELDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPVQRSMDAPSPGEWKLVFRRDDKGEITGLSVGCWLARGVEYRRV
DSQ  GCCAAACACGACATTATTGGCCGCTATCATAGTGATGAACTCGATGCCGATCTGTTGCTCGTTTCCGAAGGTGGCGCGATTTATGGCGCGTTTGAAGGTTTCCTTGGCAAGAGCGACATGTACCCGCTTTATAGTGTCGGGTCTGATGTCTGGCTGCTGCCTGTTCAGCGTTCGATGGATGCACCATCGCCCGGCGAGTGGAAGCTTGTTTTCCGACGCGACGACAAAGGTGAAATTACAGGTTTGAGCGTCGGCTGCTGGCTTGCGCGCGGTGTTGAATACAGGAGAGTT
TRN  10010101100011011
NAM  Q8YD27_BRUME/422-518
ASQ  ARQDIAGRYRSDELEADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDVWLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL
DSQ  GCAAGGCAGGATATTGCAGGGCGTTATCGCAGCGACGAGCTAGAAGCCGATCTCCTGCTCGTCAGCGAAGGCGGAGCAATCTATGGCGCCTTTGAAGGATTTCTCGGCAAAAGCGATATGTACCCGCTTTATGCGGCAGGGCCGGATGTCTGGCTGCTCCCGGTACAGCGTTCCATGGATGCGCCCTCCCCCGGCGAATGGAAGCTTGTCTTCCACCGCGATGCAGCAGGCAGGATAACCGGCGTCACGGTCGGCTGCTGGCTGGCACGCGGTGTTGAATACAAACGCCTG
TRN  10010101100011011
//