EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07907 - YibE_F)
FAM  PF07907
PID  YibE_F
DES  YibE/F-like protein
ANO  25
ALN  253
AID  0.273992
APH  ((((((((Q73PD0_TREDE/123-367:0.56984,Q8XKM7_CLOPE/130-374:0.28159):0.06180,Q97MJ0_CLOAB/132-376:0.58329):0.14563,(((Q8RHN3_FUSNN/121-365:0.64037,(((((Q8NLU1_CORGL/158-400:0.26771,Q8FU88_COREF/158-400:0.15540):0.06508,Q6NEX2_CORDI/137-379:0.25685):0.30036,Q73T89_MYCPA/163-403:0.30692):0.25862,Q72J55_THET2/80-321:0.85838):0.06600,Q82FI6_STRAW/211-453:0.46801):0.66541):0.11785,Q73KG2_TREDE/146-390:0.47816):0.10850,Q97GD2_CLOAB/136-380:0.52763):0.11613):0.23349,((Q8KU90_ENTFA/2-245:1.01615,(((Q74LS0_LACJO/2-245:0.61367,Q88Y29_LACPL/2-245:0.53103):0.09150,Q9CHC4_LACLA/2-245:0.80560):0.36100,(Q8CQT1_STAEP/2-245:0.11274,Q7A7D6_STAAN/2-245:0.11973):0.56462):0.09095):0.23392,Q97KM8_CLOAB/2-245:0.44812):0.27186):0.37776,Q97KM7_CLOAB/134-369:0.49322):0.17274,Q8KU89_ENTFA/100-337:1.01603):0.12700,(Q88Y30_LACPL/172-409:0.46653,Q9CHC5_LACLA/140-381:0.70869):0.57151):0.41930,Q7A7D5_STAAN/125-362:0.07337,Q8CQT2_STAEP/125-362:0.19140);
ATP  ((((((((Q73PD0_TREDE/123-367,Q8XKM7_CLOPE/130-374),Q97MJ0_CLOAB/132-376),(((Q8RHN3_FUSNN/121-365,(((((Q8NLU1_CORGL/158-400,Q8FU88_COREF/158-400),Q6NEX2_CORDI/137-379),Q73T89_MYCPA/163-403),Q72J55_THET2/80-321),Q82FI6_STRAW/211-453)),Q73KG2_TREDE/146-390),Q97GD2_CLOAB/136-380)),((Q8KU90_ENTFA/2-245,(((Q74LS0_LACJO/2-245,Q88Y29_LACPL/2-245),Q9CHC4_LACLA/2-245),(Q8CQT1_STAEP/2-245,Q7A7D6_STAAN/2-245))),Q97KM8_CLOAB/2-245)),Q97KM7_CLOAB/134-369),Q8KU89_ENTFA/100-337),(Q88Y30_LACPL/172-409,Q9CHC5_LACLA/140-381)),Q7A7D5_STAAN/125-362,Q8CQT2_STAEP/125-362);
ATL  17.5273
DNO  25
DLN  759
DID  0.42054
DPH  ((((((((Q8KU90_ENTFA/2-245:0.53412,(Q8CQT1_STAEP/2-245:0.13992,Q7A7D6_STAAN/2-245:0.19630):0.26935):0.08005,((Q74LS0_LACJO/2-245:0.37571,Q88Y29_LACPL/2-245:0.44514):0.08165,Q9CHC4_LACLA/2-245:0.48228):0.15210):0.14429,Q97KM8_CLOAB/2-245:0.35325):0.11540,(Q8RHN3_FUSNN/121-365:0.40562,(((Q82FI6_STRAW/211-453:0.23167,((((Q6NEX2_CORDI/137-379:0.25157,Q8NLU1_CORGL/158-400:0.21954):0.04101,Q8FU88_COREF/158-400:0.20315):0.16782,Q73T89_MYCPA/163-403:0.20502):0.13320,Q72J55_THET2/80-321:0.37728):0.12229):0.70691,Q73KG2_TREDE/146-390:0.16948):0.24806,(Q97GD2_CLOAB/136-380:0.32825,(Q8XKM7_CLOPE/130-374:0.26912,(Q73PD0_TREDE/123-367:0.39769,Q97MJ0_CLOAB/132-376:0.36149):0.06313):0.08996):0.04591):0.06014):0.06074):0.13528,Q97KM7_CLOAB/134-369:0.38793):0.09617,Q8KU89_ENTFA/100-337:0.51712):0.08768,(Q88Y30_LACPL/172-409:0.49018,Q9CHC5_LACLA/140-381:0.43934):0.21555):0.24402,Q7A7D5_STAAN/125-362:0.20845,Q8CQT2_STAEP/125-362:0.16635);
DTP  ((((((((Q8KU90_ENTFA/2-245,(Q8CQT1_STAEP/2-245,Q7A7D6_STAAN/2-245)),((Q74LS0_LACJO/2-245,Q88Y29_LACPL/2-245),Q9CHC4_LACLA/2-245)),Q97KM8_CLOAB/2-245),(Q8RHN3_FUSNN/121-365,(((Q82FI6_STRAW/211-453,((((Q6NEX2_CORDI/137-379,Q8NLU1_CORGL/158-400),Q8FU88_COREF/158-400),Q73T89_MYCPA/163-403),Q72J55_THET2/80-321)),Q73KG2_TREDE/146-390),(Q97GD2_CLOAB/136-380,(Q8XKM7_CLOPE/130-374,(Q73PD0_TREDE/123-367,Q97MJ0_CLOAB/132-376)))))),Q97KM7_CLOAB/134-369),Q8KU89_ENTFA/100-337),(Q88Y30_LACPL/172-409,Q9CHC5_LACLA/140-381)),Q7A7D5_STAAN/125-362,Q8CQT2_STAEP/125-362);
DTL  11.5167
RID  0.273992
RPH  ((((((((Q73PD0_TREDE/123-367:0.56984,Q8XKM7_CLOPE/130-374:0.28159):0.06180,Q97MJ0_CLOAB/132-376:0.58329):0.14563,(((Q8RHN3_FUSNN/121-365:0.64037,(((((Q8NLU1_CORGL/158-400:0.26771,Q8FU88_COREF/158-400:0.15540):0.06508,Q6NEX2_CORDI/137-379:0.25685):0.30036,Q73T89_MYCPA/163-403:0.30692):0.25862,Q72J55_THET2/80-321:0.85838):0.06600,Q82FI6_STRAW/211-453:0.46801):0.66541):0.11785,Q73KG2_TREDE/146-390:0.47816):0.10850,Q97GD2_CLOAB/136-380:0.52763):0.11613):0.23349,((Q8KU90_ENTFA/2-245:1.01615,(((Q74LS0_LACJO/2-245:0.61367,Q88Y29_LACPL/2-245:0.53103):0.09150,Q9CHC4_LACLA/2-245:0.80560):0.36100,(Q8CQT1_STAEP/2-245:0.11274,Q7A7D6_STAAN/2-245:0.11973):0.56462):0.09095):0.23392,Q97KM8_CLOAB/2-245:0.44812):0.27186):0.37776,Q97KM7_CLOAB/134-369:0.49322):0.17274,Q8KU89_ENTFA/100-337:1.01603):0.12700,(Q88Y30_LACPL/172-409:0.46653,Q9CHC5_LACLA/140-381:0.70869):0.57151):0.41930,Q7A7D5_STAAN/125-362:0.07337,Q8CQT2_STAEP/125-362:0.19140);
RTP  ((((((((Q73PD0_TREDE/123-367,Q8XKM7_CLOPE/130-374),Q97MJ0_CLOAB/132-376),(((Q8RHN3_FUSNN/121-365,(((((Q8NLU1_CORGL/158-400,Q8FU88_COREF/158-400),Q6NEX2_CORDI/137-379),Q73T89_MYCPA/163-403),Q72J55_THET2/80-321),Q82FI6_STRAW/211-453)),Q73KG2_TREDE/146-390),Q97GD2_CLOAB/136-380)),((Q8KU90_ENTFA/2-245,(((Q74LS0_LACJO/2-245,Q88Y29_LACPL/2-245),Q9CHC4_LACLA/2-245),(Q8CQT1_STAEP/2-245,Q7A7D6_STAAN/2-245))),Q97KM8_CLOAB/2-245)),Q97KM7_CLOAB/134-369),Q8KU89_ENTFA/100-337),(Q88Y30_LACPL/172-409,Q9CHC5_LACLA/140-381)),Q7A7D5_STAAN/125-362,Q8CQT2_STAEP/125-362);
RTL  17.5273
LNK  Q6NEX2_CORDI/137-379:Q6NEX2:BX248360
LNK  Q72J55_THET2/80-321:Q72J55:AE017304
LNK  Q73KG2_TREDE/146-390:Q73KG2:AE017253
LNK  Q73PD0_TREDE/123-367:Q73PD0:AE017248
LNK  Q73T89_MYCPA/163-403:Q73T89:AE017241
LNK  Q74LS0_LACJO/2-245:Q74LS0:AE017200
LNK  Q7A7D5_STAAN/125-362:Q7A7D5:BA000018
LNK  Q7A7D6_STAAN/2-245:Q7A7D6:BA000018
LNK  Q82FI6_STRAW/211-453:Q82FI6:BA000030
LNK  Q88Y29_LACPL/2-245:Q88Y29:AL935254
LNK  Q88Y30_LACPL/172-409:Q88Y30:AL935254
LNK  Q8CQT1_STAEP/2-245:Q8CQT1:AE016751
LNK  Q8CQT2_STAEP/125-362:Q8CQT2:AE016751
LNK  Q8FU88_COREF/158-400:Q8FU88:BA000035
LNK  Q8KU89_ENTFA/100-337:Q8KU89:AF454824
LNK  Q8KU90_ENTFA/2-245:Q8KU90:AF454824
LNK  Q8NLU1_CORGL/158-400:Q8NLU1:BA000036
LNK  Q8RHN3_FUSNN/121-365:Q8RHN3:AE010500
LNK  Q8XKM7_CLOPE/130-374:Q8XKM7:BA000016
LNK  Q97GD2_CLOAB/136-380:Q97GD2:AE007743
LNK  Q97KM7_CLOAB/134-369:Q97KM7:AE007604
LNK  Q97KM8_CLOAB/2-245:Q97KM8:AE007604
LNK  Q97MJ0_CLOAB/132-376:Q97MJ0:AE007534
LNK  Q9CHC4_LACLA/2-245:Q9CHC4:AE006314
LNK  Q9CHC5_LACLA/140-381:Q9CHC5:AE006314
AMK  xxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q97KM8_CLOAB/2-245
ASQ  NVPFLLLIILFILMIIVGG.KRGVKSFFTLILN--FVIMLILLILIGAKFDPLKVTIIGCIIITITTLFFINSFNLKTLSSLFSVVIVVALTLIITYNLSSKAQIQGFGKEQAESLGYLSTYVQLNFSKIVSCQILLGLLGAIIDVSISISSSLHELYLNNP....SHTKYELFKSGINIGKDILGTMTNTLLFAYIGSFMT..LSIYFSEVHYSFYDILNTKVFCSELFQSFSSGIGIILIIPITSFITSRL
DSQ  AATGTTCCATTTTTATTACTTATCATTCTTTTTATCTTGATGATAATAGTTGGAGGA...AAAAGAGGAGTAAAATCATTTTTTACACTGATTCTTAAT------TTCGTAATAATGCTAATTCTGTTAATTTTAATAGGCGCTAAGTTTGACCCTTTAAAGGTAACAATAATAGGATGTATTATAATAACAATTACTACCTTATTTTTTATAAATAGCTTTAATTTAAAAACTTTATCCTCTTTATTTTCTGTTGTCATAGTAGTTGCGTTAACTCTTATAATAACCTACAACCTAAGTAGTAAAGCTCAAATACAAGGTTTTGGAAAAGAACAAGCAGAATCGTTAGGTTACCTATCTACCTACGTACAGCTAAATTTCTCAAAAATAGTATCGTGTCAAATACTTTTGGGGCTACTTGGAGCCATAATAGATGTATCCATATCTATATCTTCTTCGCTACATGAACTATATTTAAACAATCCT............TCTCATACAAAATATGAGCTATTTAAATCTGGTATTAACATTGGCAAGGATATTCTTGGTACAATGACAAACACTCTTCTTTTCGCTTATATAGGAAGCTTTATGACA......CTTTCAATATATTTCAGTGAAGTGCATTATTCCTTTTATGACATACTAAACACCAAGGTATTTTGCTCTGAACTATTTCAAAGCTTCTCCAGTGGTATAGGTATAATCCTAATAATTCCAATTACTTCTTTTATAACTTCAAGACTT
TRN  10010101100011000
NAM  Q7A7D6_STAAN/2-245
ASQ  NAVFILALLLLFLMIIFGG.KKGFISYLTLFLN--FAILIISIVLIIFGVPIYVVTFFFCIIIGACNLFVLNSYNVKTQAAFISTIVTTILLITLIYLSVYFGHLQGFSTEQQDETYVYSMNIGIDMVQFMVFTIILAVIAAVIDLTITISSPIYELHQVNP....TLTQYELFQSGMRVGREILATSANTIYLAFFGGQLA..LFIWFFKLKYSFGHIINSKIFAQEFISIILGGIAVAISIPITAWITAFL
DSQ  AATGCTGTATTTATATTGGCGTTATTGCTCCTCTTTCTGATGATAATTTTCGGAGGT...AAAAAGGGATTCATCTCTTATTTAACCCTATTTTTAAAT------TTCGCTATTTTAATTATTAGTATTGTATTGATTATTTTTGGCGTACCGATTTATGTCGTCACATTCTTTTTCTGCATTATTATTGGCGCTTGTAATTTATTCGTACTCAATAGTTACAATGTTAAAACACAAGCTGCATTTATCAGCACTATCGTTACAACAATATTGTTGATTACACTCATTTATTTATCTGTCTACTTCGGTCATCTACAAGGCTTTTCAACCGAACAACAAGATGAAACATATGTGTATTCAATGAATATTGGCATTGATATGGTTCAATTTATGGTGTTCACTATTATTCTTGCTGTTATTGCAGCTGTGATAGATTTAACGATTACCATTAGTTCACCCATTTATGAATTGCATCAAGTAAATCCA............ACACTTACGCAATACGAATTATTCCAATCTGGCATGCGTGTTGGTAGAGAAATTTTAGCGACATCTGCGAACACGATTTACCTTGCCTTTTTTGGTGGCCAACTTGCT......TTATTTATTTGGTTTTTCAAACTTAAATATTCATTTGGTCATATTATAAACTCGAAAATATTTGCCCAAGAATTTATTTCTATTATTTTAGGCGGTATTGCCGTTGCAATCAGTATTCCGATTACGGCTTGGATTACGGCATTTTTA
TRN  10010101100011000
NAM  Q8CQT1_STAEP/2-245
ASQ  SAITILGFLLLLIMVIFGG.KKGLISFFTLFLN--FIILVISILLIIYGVPIYLVTFIFCFIIAAINLFVLNSYNVKTQAAFLGTLVTILILILMIYFSVEMGHLQGFATEQQDETYVYSMNIGINMVQFMVFTIVLAVIAAVIDLAITISSPMYELNETNP....NLNQHQLFQSGMRVGREILATSANTIYLAFFGGQLT..LFFWFFKLKYSFGHIINSKIFTQEFIAILLGGIAVAISIPITAWITAFM
DSQ  AGTGCAATTACTATTTTAGGTTTCTTATTATTGTTGATAATGGTTATTTTCGGAGGT...AAAAAAGGACTCATTTCTTTTTTCACTTTGTTTTTAAAT------TTTATCATTCTTGTAATAAGTATTCTTTTAATTATATATGGTGTGCCAATCTATCTTGTCACATTTATATTTTGCTTTATCATAGCCGCAATTAATTTATTTGTATTAAATAGTTACAATGTAAAAACACAAGCGGCTTTTCTAGGTACTTTAGTAACAATACTTATATTAATACTCATGATATACTTTTCAGTTGAGATGGGTCACTTACAAGGTTTTGCCACCGAACAGCAGGATGAAACATATGTGTATTCAATGAATATTGGTATTAATATGGTACAATTTATGGTATTTACAATTGTTCTTGCAGTGATAGCTGCAGTCATTGATTTAGCAATAACAATTAGTTCCCCTATGTATGAACTAAATGAGACTAATCCA............AATTTAAATCAGCATCAATTATTTCAGTCTGGTATGCGTGTGGGTAGAGAGATATTAGCAACTTCTGCCAACACCATTTATTTAGCATTTTTCGGAGGACAATTAACT......TTATTCTTCTGGTTCTTTAAATTAAAATATTCATTTGGACACATCATTAATTCGAAGATATTCACACAGGAATTTATAGCTATTTTACTTGGTGGTATCGCCGTTGCAATTAGCATTCCCATTACTGCATGGATTACAGCATTTATG
TRN  10010101110011000
NAM  Q9CHC4_LACLA/2-245
ASQ  NALLILLILLIVLMLIVAK.KDGLRNLIGLTFN--FIAIFVLITLISWGFNAIAVLIVLSVIILAIAIFMSADESEVTLIAFKTSIIVVLSLLILALIIQHFGQFQGFATEDVDELENLSLNVGLNFSNVAIVVMVISMLGAVAESAMALAASLSEVVEQDE....NMSLDQFKNQREIISQQILGTAVNTLFFGVLGATVG..LILWFVRLNYRLADIFNSKLLMAEVAAMLLGMLGILFAIWLSGYFVQKS
DSQ  AATGCACTCTTGATCCTATTAATTTTACTGATTGTGTTGATGCTTATCGTTGCCAAA...AAAGATGGCTTACGAAATTTAATTGGTTTGACCTTTAAT------TTTATTGCTATTTTTGTGTTAATTACTTTAATTTCTTGGGGATTTAATGCAATAGCAGTTCTGATAGTTCTGTCAGTAATTATTTTGGCAATAGCTATCTTTATGTCTGCTGATGAAAGTGAAGTCACGTTGATTGCTTTTAAAACGAGTATCATTGTTGTTTTATCTTTGCTCATTCTTGCTTTAATCATTCAACATTTTGGTCAATTTCAGGGATTTGCTACAGAAGATGTTGATGAATTGGAAAATCTGTCATTAAATGTGGGGCTTAATTTTTCAAATGTAGCCATTGTAGTCATGGTTATTTCCATGCTTGGAGCGGTAGCAGAATCAGCAATGGCTTTAGCAGCTAGCCTTTCGGAAGTTGTTGAGCAGGACGAA............AACATGAGTCTTGACCAATTTAAAAATCAAAGAGAAATTATATCTCAACAAATTTTGGGAACGGCTGTCAATACCCTCTTTTTTGGAGTTTTGGGGGCAACTGTCGGT......CTAATTCTCTGGTTTGTACGTTTAAACTATCGCTTGGCGGATATTTTTAATTCAAAATTGCTGATGGCCGAAGTTGCCGCCATGCTTTTAGGAATGTTAGGGATTCTATTTGCAATTTGGCTTTCTGGTTATTTTGTTCAAAAATCT
TRN  10010101100011000
NAM  Q88Y29_LACPL/2-245
ASQ  NTITVLGLILLGLMTLIGG.KTGATAFLSLLFN--FGLLFLAVVLISWGFPAMGVSLVIGTIILAFTIFFGEDNEVAAKPAYIAALIVMVMLVLIIFPVENWIMAQGFSLEDSEDLEGMSLAIGVSFIGVAVTEAILSTLGAIAEAAIAIAAGLSEILAQHP....QLPTKRLYIDGISIGKQIIGTTFNTLFFGFFGGFLA..LFIWFAGLHYSFGSVINNKIFVAEVLMVLFSLIGVILVVPVTTWVMTIQ
DSQ  AACACGATTACCGTTTTAGGATTGATCTTACTAGGCTTGATGACATTAATTGGTGGT...AAGACTGGAGCGACGGCCTTTTTGAGTTTGTTATTTAAC------TTTGGATTGTTGTTTTTAGCCGTTGTTTTGATTTCATGGGGCTTTCCAGCAATGGGGGTGTCGTTGGTCATTGGGACAATCATCTTGGCCTTCACGATTTTCTTTGGGGAGGACAACGAAGTGGCGGCCAAGCCAGCTTATATTGCAGCATTGATTGTTATGGTCATGTTAGTGCTGATTATTTTTCCCGTTGAAAATTGGATCATGGCGCAGGGCTTTAGTTTAGAAGATAGTGAAGATCTGGAAGGTATGTCGTTAGCCATTGGGGTCTCCTTTATTGGCGTAGCAGTAACTGAAGCAATTTTAAGTACACTAGGGGCCATTGCGGAAGCTGCTATTGCGATTGCGGCTGGTCTGAGTGAAATTCTGGCGCAGCATCCG............CAGTTGCCAACTAAGCGACTCTATATCGATGGTATCAGTATTGGTAAGCAGATTATCGGGACGACTTTTAATACCTTGTTTTTCGGCTTTTTTGGTGGCTTCTTGGCG......CTATTTATCTGGTTTGCGGGCTTACATTATTCCTTCGGGAGTGTTATCAATAATAAAATATTTGTTGCGGAAGTATTAATGGTATTATTCTCGTTAATTGGCGTTATCCTGGTAGTTCCCGTCACGACGTGGGTGATGACGATTCAA
TRN  10010101100011000
NAM  Q74LS0_LACJO/2-245
ASQ  TTLTALLLILLILMIIVGG.KTGFKSYLSVVIN--ACLLILVALLISWGVNIVLVGAIFIPLKLLTIIYLGTHDYTVAKNAFLTALCVSVIVMLIIILFENLAQTQGFGDQAGEELIGLSLNVGISFSQIAILVAIFSMLGAIAEASVAMSAGLLELKRHDP....NITQKQLIESGNEVGADVLGTAMNTILFGLFGSFLP..IFIWYMRLNYSLFEILNDKLFVDEFLIIVYSFIGVLLTVPLTTIFLAHT
DSQ  ACAACTTTAACTGCTCTTTTATTAATTCTTTTGATATTGATGATTATAGTTGGAGGA...AAAACTGGCTTTAAGAGTTATCTAAGCGTCGTTATCAAT------GCCTGTTTACTGATTTTAGTTGCACTGCTTATTTCTTGGGGAGTAAATATTGTATTAGTCGGAGCAATATTTATTCCTTTGAAATTACTGACGATTATTTATTTAGGAACACATGATTATACTGTAGCCAAAAATGCCTTTTTAACTGCCTTATGTGTAAGTGTAATTGTAATGCTGATAATTATCTTGTTTGAAAATTTAGCGCAAACTCAAGGCTTTGGAGACCAGGCAGGGGAAGAATTAATTGGTTTATCATTAAATGTAGGAATTAGTTTTTCTCAAATCGCAATTTTAGTTGCAATCTTTTCAATGCTAGGTGCAATTGCGGAAGCCAGTGTTGCAATGAGTGCTGGTTTACTTGAGTTAAAGCGGCATGACCCT............AACATTACTCAAAAGCAATTAATCGAAAGCGGAAATGAAGTTGGTGCGGATGTATTAGGGACCGCCATGAATACAATCTTATTTGGTTTATTTGGTAGTTTTCTCCCA......ATATTTATTTGGTATATGAGACTAAATTATTCCTTATTTGAAATTTTAAATGATAAACTTTTTGTGGATGAGTTTTTAATTATTGTATATTCGTTCATTGGCGTGCTTTTAACGGTACCATTAACTACAATATTCTTAGCACATACT
TRN  10010101100011000
NAM  Q8KU90_ENTFA/2-245
ASQ  NVISLLVIIFIFISIIIFK.NNSFYFISGLFLN--IVIFIGYLIAISLHISVYLVTFVSFLLMTIVILYWINGRNAKTKLAFICVIFFLVTFTIVSLPLITALKTQGFSSEELIELANFDLNVDIPFSELNVSIILISFSGAVIDGSMAICSSTYEIYTKNP....DLTFKELFNSSFNVVIEVLNSTIYTLLFAFIASNFA..LVIYLQDLNYSFLELINSKIFVGELLVSILTGCAGILILPLSCLLGSWI
DSQ  AATGTAATTAGTTTATTAGTCATTATTTTTATCTTTATTTCAATTATCATATTTAAA...AATAATTCTTTCTACTTTATTTCAGGATTATTTTTGAAT------ATAGTCATTTTTATTGGCTATCTAATAGCTATATCGCTTCATATTTCTGTATATTTGGTAACCTTTGTATCTTTTTTACTAATGACGATAGTAATTCTTTATTGGATAAATGGACGTAATGCTAAAACAAAATTGGCTTTTATCTGTGTTATATTTTTTTTAGTTACTTTTACTATTGTGTCACTACCATTAATCACTGCTCTTAAGACACAAGGATTTTCTTCTGAAGAATTAATTGAATTAGCTAATTTTGATTTAAATGTTGATATCCCTTTTTCTGAACTAAACGTCTCAATTATTTTAATTAGTTTTTCTGGTGCCGTTATTGACGGAAGTATGGCTATTTGTAGTTCTACTTACGAAATATATACGAAGAACCCA............GATTTAACTTTTAAAGAACTATTTAATTCTAGTTTTAACGTAGTAATTGAGGTATTAAATTCGACTATATACACTCTCTTATTTGCTTTTATAGCATCTAATTTTGCA......TTAGTAATTTACTTACAGGATTTAAACTATTCATTTTTAGAATTAATTAATTCTAAAATTTTTGTAGGGGAACTATTAGTAAGTATTTTAACTGGTTGTGCAGGAATTTTAATTTTACCTTTGTCCTGTTTACTAGGTAGCTGGATA
TRN  10010101110011000
NAM  Q97KM7_CLOAB/134-369
ASQ  KYVFYVAFIFILLIIAISG.KTGLRSLVSVVIN--IVIFSIVIELFLNNFSIAFIFLTAMLLFTVLSLIMVSGLNKKTISAVVSTLLGTTITILIAIAAIKLNNSNGVRFEEME-------FLTHPPEKMFYIELLVGTLGAIMDIAISISAAINELYLKNP....SIETKSLIKSGLEIGKDIMGTMSNTMLFAYFSGSIP..FIILLLRNQTPLYNILNEN-LSLEILRALTGSIGIVISIPISIFVAVVL
DSQ  AAATATGTATTTTACGTGGCTTTCATTTTTATATTACTTATAATTGCAATATCAGGT...AAAACAGGACTACGCTCCTTAGTAAGTGTGGTAATAAAT------ATAGTAATATTCTCTATAGTAATAGAGCTTTTTTTGAATAACTTTAGTATCGCATTTATATTCTTAACAGCTATGCTGCTTTTTACAGTTTTATCTCTTATTATGGTGTCAGGGTTAAACAAAAAAACAATTTCTGCAGTGGTTTCTACTTTGCTTGGAACAACAATAACAATTTTAATAGCTATAGCTGCAATAAAATTAAATAACTCAAACGGAGTTAGGTTTGAGGAGATGGAA---------------------TTTTTAACTCATCCGCCTGAAAAAATGTTTTATATAGAACTTTTAGTAGGTACCTTAGGTGCTATTATGGACATAGCAATTTCAATTTCAGCTGCTATAAATGAACTTTATTTAAAAAATCCA............AGTATAGAAACAAAATCACTTATAAAATCAGGATTAGAAATAGGCAAGGATATTATGGGGACTATGTCAAACACTATGCTTTTTGCATATTTTAGTGGAAGTATTCCT......TTTATAATACTGCTTCTTAGAAATCAAACTCCTCTCTACAACATACTAAATGAAAAT---TTATCTCTTGAGATACTGAGGGCCCTTACCGGAAGTATAGGAATAGTAATTAGTATACCTATTTCTATCTTTGTAGCTGTAGTACTT
TRN  10010101100011000
NAM  Q8CQT2_STAEP/125-362
ASQ  TIVVIITGLFLLTVLVVGK.KVGLQSILSLIVNTIAVMGAILIHDQYGAISLFFLMTCAIIISTSFTLLLVTGWHSRTLITIVSTLIGTFLCVGITEVIIKFTGGNGIKYETIT-------FLTLPPKDVFLASVLIGTLGAVMDVSITIASGMYEILKRSP....QISMKRWALAGRHIGQDIMGTMTNILLFSYLSGSLP..MFLIYLKNANTITYTISMN-WSLEVARALTGGIGIVLTIPITIALMELW
DSQ  ACTATTGTTGTCATAATAACCGGCTTATTTTTACTTACTGTTTTAGTTGTAGGAAAA...AAAGTAGGACTTCAATCTATATTATCTCTTATCGTTAATACCATTGCCGTTATGGGAGCTATTTTAATACATGATCAATATGGGGCTATAAGTTTATTCTTTTTGATGACTTGTGCTATTATCATTTCCACTTCTTTCACTTTACTACTTGTAACAGGTTGGCATAGCCGAACCTTAATTACTATTGTAAGTACGCTGATTGGTACGTTCTTATGTGTTGGAATTACCGAAGTCATCATCAAATTTACCGGGGGAAATGGAATAAAATACGAAACAATCACT---------------------TTCCTTACTCTCCCTCCTAAGGATGTCTTTCTAGCTTCCGTACTAATAGGTACACTTGGAGCAGTGATGGATGTTTCTATTACTATTGCAAGTGGGATGTACGAAATTTTAAAACGTAGCCCT............CAAATTTCCATGAAACGTTGGGCTCTTGCCGGAAGACATATCGGTCAGGATATAATGGGAACAATGACTAATATACTTCTCTTTTCATATCTATCTGGTAGCTTACCT......ATGTTTCTAATTTATTTAAAAAATGCTAACACTATTACTTATACTATTTCGATGAAT---TGGTCATTAGAAGTTGCTCGAGCATTAACTGGTGGGATAGGTATCGTTTTAACTATTCCTATAACAATTGCTTTAATGGAACTATGG
TRN  10010101100011000
NAM  Q7A7D5_STAAN/125-362
ASQ  TLTVIITGLFLLTVLLVGR.KVGLQSILSLILNSIAILIAIYIHIQHSNINLFLLMTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTELIIYMTDGKGIKYETMN-------FLSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTP....HISMRRWALAGRNIGQDIMGTMTNILLFSYLSGALP..MFLIFLKNANTVTYTISMN-WSLEIARALTGGIGIVLTIPITILFMEIF
DSQ  ACCTTAACGGTTATCATCACTGGTTTGTTCTTATTAACTGTATTATTGGTTGGTCGC...AAAGTCGGACTGCAATCGATTTTATCGTTAATCTTGAATTCTATTGCCATATTAATCGCAATTTACATTCATATTCAACATAGCAATATTAATTTATTCTTACTCATGACCATTGCCATGATCTGTTCAACAATACTCACTTTATTGCTCGTTACAGGCTGGCATATGCGTACACTCATTACCATAGCCAGTACAATTATCGGAACTTTTTTGAGTATAGGTTTAACAGAATTAATCATATATATGACAGATGGTAAAGGCATTAAATATGAAACGATGAAC---------------------TTTTTATCATTACCACCGAAAGATATCTTCCTAGCCTCAGTGTTAATAGGTTCACTTGGCGCTATTATGGATGTTGCAATTACAATTGCTAGTGGTATGCATGAAATTTTACAGCGTACGCCA............CACATTTCAATGAGGAGATGGGCGCTTGCTGGGCGAAACATCGGCCAAGATATTATGGGAACAATGACTAACATCTTATTATTCTCATATTTATCCGGTGCACTACCT......ATGTTTTTAATCTTTTTAAAAAATGCAAATACTGTGACTTATACTATTTCGATGAAT---TGGTCGTTAGAAATTGCGCGCGCACTAACAGGCGGTATAGGTATCGTACTTACAATTCCTATCACAATATTGTTTATGGAAATATTT
TRN  10010101100011000
NAM  Q8KU89_ENTFA/100-337
ASQ  GYTFILVVSFVSLVLGIAG.KKGFFSLVGILFNIIFLFFLLWINQRNRSINLLLLISIYTIIAIIISTGTLYGLKKIDLRKVLATIFSVFLSYFITTITMKLLNDQGLRYEEMQ-------FLTRPYRTVFLASLMLGGIGAALDNVVVIISSLDQLVRHTP....EINTKELIESGKNIASDTTTSMINVLLFAYLSSATP..FFIFYLANGWDFVETFKMH-LSLEIMRILCGGLAILFTIPSSFLFFLLF
DSQ  GGCTATACTTTTATTTTAGTAGTTAGTTTTGTTTCATTAGTCTTAGGTATCGCTGGA...AAAAAAGGATTTTTTTCTTTAGTTGGTATTTTATTCAATATAATCTTTCTTTTTTTCTTGCTTTGGATAAATCAGCGAAACAGATCCATAAACTTACTATTGCTAATATCAATCTATACAATAATTGCTATTATTATATCAACTGGTACTCTCTACGGACTAAAAAAAATTGATTTAAGGAAGGTTTTAGCAACAATATTTAGTGTTTTTCTATCTTATTTTATTACCACAATTACTATGAAATTATTAAACGATCAAGGACTGCGCTATGAAGAAATGCAA---------------------TTTTTAACTAGACCTTATCGAACTGTTTTTCTTGCCAGCTTAATGTTAGGAGGAATTGGAGCAGCACTAGACAATGTTGTTGTTATAATTTCAAGTTTAGATCAACTTGTAAGACATACTCCT............GAGATAAATACAAAAGAATTAATAGAATCAGGAAAGAATATCGCTTCAGATACCACTACTTCGATGATTAATGTTTTGTTATTTGCCTATCTAAGTAGTGCAACGCCT......TTTTTTATTTTCTATTTAGCTAATGGATGGGATTTTGTTGAGACATTCAAAATGCAT---CTTTCATTGGAAATAATGAGAATTTTATGTGGAGGACTTGCCATCTTGTTCACTATCCCAAGTTCATTTCTATTTTTTCTTTTATTT
TRN  10010101100011000
NAM  Q8RHN3_FUSNN/121-365
ASQ  IELYVMGIGFVALVLLIAR.KNGLKSLFALTVT-IAFIIKIFIPAIYNGYSPILFAIITAVFSSLVTIYFTVGMNKKFIVALLGVTGGVLIAGILSYIFTYRMRLNGFLDSDLLACAYL--FKNIKMKEIIPAGVIIGSLGAVMDVAVSIASSINELHEIDP....NISKKSMFKSAINIGNDIIGTMINTLILAYIASAIFtlLLIYMQANEYPLIRILNFQDIAVEIMRSICGSIGILIAVPLTAYIGTLI
DSQ  ATAGAGCTATATGTAATGGGAATTGGTTTTGTTGCTCTTGTTCTTTTAATTGCAAGA...AAAAATGGATTAAAGTCTCTGTTTGCTTTGACAGTAACT---ATTGCCTTTATTATAAAAATCTTTATTCCTGCAATATATAATGGATATTCTCCAATACTTTTTGCTATAATAACTGCTGTATTCTCATCACTAGTAACAATATATTTTACAGTAGGTATGAATAAAAAATTTATTGTTGCCTTATTAGGTGTTACAGGTGGAGTTTTAATAGCAGGTATACTTTCATATATATTTACATATAGAATGCGTCTTAATGGTTTCTTAGACTCCGATCTTTTAGCTTGTGCTTATCTT------TTTAAAAACATAAAAATGAAAGAAATTATTCCAGCAGGAGTTATTATAGGAAGTTTAGGTGCTGTAATGGATGTGGCAGTTTCTATAGCATCATCTATCAATGAATTACATGAAATAGATCCA............AATATATCTAAAAAATCTATGTTTAAGTCCGCTATAAATATTGGTAATGATATTATAGGAACTATGATTAATACACTAATTCTTGCCTATATTGCAAGTGCTATATTTacattaTTGCTTATCTATATGCAAGCAAATGAATATCCACTTATTAGAATTTTAAATTTCCAAGATATTGCTGTTGAAATTATGAGATCTATCTGTGGAAGTATTGGAATTTTAATAGCTGTTCCTTTAACTGCATATATAGGTACTTTGATT
TRN  10010101100011000
NAM  Q97MJ0_CLOAB/132-376
ASQ  PVEYAFIFIFFAALCFIGG.KNGFKSIIGIVST-LICIIFLFVPMIYNGYSPILACLLIVVLTTCTTLFLLDGISAKTISAAFGTILGVVISIIVGIIFGGLSHLSGLNMENAETLSLISTKTDMKVQGLLLTCVIIASLGALLDLSVSIASSIQEVYQSNK....KLTVKQLFKSGMNIGKDLMGTMANTLILAFTGSSLN..VLVVIYAYNISFTQMINMDIISVEIIEGVAGSLAVVLTVPITAFICSKI
DSQ  CCAGTGGAATACGCATTTATATTTATATTTTTTGCAGCGTTATGTTTTATAGGAGGA...AAGAATGGATTTAAATCGATAATAGGAATAGTGTCTACA---TTGATATGTATAATATTCCTATTTGTTCCTATGATCTACAACGGGTATTCTCCTATATTAGCATGCCTTTTAATAGTAGTCTTAACAACCTGTACTACTTTGTTTTTACTTGATGGTATTAGTGCCAAAACAATATCCGCTGCATTTGGAACAATTTTAGGAGTGGTTATTTCAATTATTGTAGGAATTATTTTTGGAGGATTAAGTCATCTTTCAGGTTTAAATATGGAGAATGCAGAAACTTTAAGCTTGATTTCTACCAAAACAGATATGAAAGTTCAAGGCTTATTGCTAACTTGTGTAATTATAGCATCTTTAGGAGCACTTCTAGATTTAAGTGTATCCATAGCATCTTCAATACAAGAAGTGTATCAGTCAAACAAA............AAGCTTACCGTAAAACAACTTTTTAAATCTGGGATGAATATAGGAAAAGATTTAATGGGGACTATGGCAAATACTCTTATTCTTGCGTTTACAGGATCTTCTCTTAAT......GTTCTGGTAGTTATATATGCCTATAATATTAGCTTTACTCAAATGATAAATATGGACATAATTAGTGTAGAGATAATCGAAGGAGTTGCCGGAAGTTTAGCGGTAGTTTTAACTGTACCAATTACCGCATTTATATGTTCCAAAATA
TRN  10010101100011000
NAM  Q8XKM7_CLOPE/130-374
ASQ  NIIFLLVLLFVIVIIGVGG.IKGIKSLVSLFFT-CVCIIFLMIPLMLRGVNPILAAIFSALISIIVTLVLVSGINKKTFTAILGTLSGIIISGVIAIGFGKLANLSGISMEEAESMMYIAENTSLNIHGIMFAAILIASLGAVMDVAMSISSSIFEINDIND....TLNKRGLFKSGMNIGKDIIGTMANTLILAFAGGSLN..TIIMLYASNMSKNQILNLDVLCIEVVQGLAGSIGIILTVPITAFVASYF
DSQ  AACATAATATTTTTGCTAGTACTATTATTTGTAATAGTCATAATAGGAGTAGGTGGA...ATAAAGGGAATAAAATCATTAGTTTCACTGTTTTTTACT---TGTGTTTGTATAATATTTTTAATGATTCCATTGATGTTAAGAGGGGTAAATCCAATATTAGCAGCAATTTTTTCAGCACTTATAAGTATTATTGTTACATTGGTTTTAGTTTCGGGAATAAATAAAAAAACTTTTACTGCTATTTTAGGAACTTTAAGTGGAATAATTATATCAGGGGTAATAGCAATAGGTTTTGGAAAACTTGCAAATTTATCAGGTATTAGTATGGAAGAAGCTGAAAGTATGATGTATATAGCTGAAAATACTTCCTTAAATATTCATGGAATAATGTTTGCAGCTATATTAATAGCATCTTTAGGGGCAGTTATGGATGTTGCTATGTCTATTTCCTCATCAATTTTCGAAATAAATGATATTAATGAT............ACTTTAAATAAAAGAGGATTATTTAAAAGTGGAATGAATATAGGAAAAGATATAATAGGAACAATGGCTAATACATTAATATTAGCTTTTGCTGGAGGGTCCTTAAAT......ACAATAATAATGTTATATGCTTCTAATATGAGTAAAAATCAAATATTAAATTTAGATGTGCTTTGTATAGAAGTTGTGCAAGGGCTTGCAGGCAGTATAGGAATTATACTTACAGTGCCAATAACAGCTTTTGTAGCAAGTTATTTT
TRN  10010101100011000
NAM  Q73PD0_TREDE/123-367
ASQ  THIYILVLLFALSLIFLGK.RQGFKSLLGLVFT-CTVIVSLLVPALFAGFAPIPISILLVSVVTFVSFILVSGFSRKTYAAILGTICGISIAGLISIIVSYTANLSGVNMEGGEQLLNIAPDYNLKLNGLLFISILIASLGAVMDVSMSVSSSMHEILTIDP....TIEKKKLFKSGLNVGKDITGTMSNTLILAFAGTSLP..LIMMIWGYGMSLRQFINIPKIVIHIVQGLAGSMGIITSVPCTAFFAAVL
DSQ  ACCCATATTTATATCTTAGTCTTGCTCTTTGCCCTTTCTTTAATTTTTCTCGGCAAA...AGGCAGGGCTTTAAGTCTTTACTGGGTTTGGTTTTTACA---TGTACAGTTATTGTGAGCCTTTTAGTTCCTGCTTTATTTGCGGGCTTTGCACCTATTCCTATTTCCATTTTACTTGTTTCGGTAGTCACCTTCGTAAGTTTTATTTTGGTAAGCGGTTTTTCCCGTAAGACCTATGCTGCAATACTCGGGACCATTTGCGGAATAAGTATAGCAGGGCTTATTTCGATAATAGTTTCCTATACGGCAAATCTTTCGGGTGTGAATATGGAAGGAGGAGAACAGCTTTTGAATATTGCCCCTGATTATAATCTAAAATTAAACGGGCTTCTTTTTATTTCTATTTTAATTGCTTCTCTTGGGGCTGTAATGGATGTAAGTATGTCCGTCTCCTCTTCGATGCACGAAATATTAACAATAGATCCT............ACAATCGAAAAAAAGAAATTATTTAAATCAGGCCTAAATGTAGGAAAGGATATAACCGGAACTATGAGTAATACTCTTATTCTGGCCTTTGCAGGGACATCTCTGCCT......TTGATAATGATGATATGGGGATATGGCATGAGTTTAAGGCAATTTATAAATATACCAAAAATTGTAATACATATTGTACAAGGGCTTGCCGGCAGTATGGGTATAATAACATCTGTTCCATGTACGGCATTTTTTGCGGCAGTGCTT
TRN  10010101100011000
NAM  Q73KG2_TREDE/146-390
ASQ  YKVYALIFIFAAVLIFVGK.KNGLKALISLGLT-IGLIFGIFLPLILQGHNPILWAIIICSLASVITLFIISGMNNKTYTAILGTIGGVIIAGLFAFVAGKILRLSGLGNEDAQMLAFVPQYRKIDYQGLLFAGIMIGSLGAVMDVAMSISSSMWEIVAVSP....KIPNKQLIKSGMNIGRDIIGSMSNTLILAYVSTSIP..VLLLFIIFSHGFTEIINLEILSAEILRAVSGSIGLICTIPITVNLVNIF
DSQ  TATAAGGTCTATGCTCTTATTTTTATTTTTGCAGCGGTTTTAATTTTTGTCGGCAAA...AAAAACGGTCTAAAAGCTCTTATCTCCCTGGGGCTTACC---ATAGGCCTGATATTCGGCATTTTTCTTCCTCTTATACTTCAAGGTCATAATCCTATTCTTTGGGCTATTATAATTTGCAGCCTTGCTTCCGTTATTACTCTTTTTATTATTTCGGGAATGAATAATAAAACCTATACGGCAATTTTGGGAACTATAGGCGGTGTTATTATCGCAGGTCTTTTTGCCTTTGTTGCAGGAAAAATTTTAAGACTTTCAGGTTTGGGAAACGAAGATGCTCAAATGTTAGCCTTTGTTCCGCAGTACCGTAAAATAGATTATCAGGGACTTTTATTTGCCGGCATTATGATAGGCTCCCTCGGAGCCGTTATGGATGTAGCTATGTCTATTTCTTCTTCGATGTGGGAGATTGTAGCTGTAAGTCCT............AAGATACCGAATAAACAGCTGATCAAATCGGGGATGAATATAGGGCGGGATATTATAGGCTCAATGTCCAATACGCTTATTTTAGCCTATGTGAGTACGTCAATTCCC......GTTCTTTTACTCTTTATAATTTTTTCGCACGGGTTTACCGAAATCATAAATTTGGAAATTTTATCGGCCGAGATATTGCGTGCCGTCTCCGGAAGTATAGGTTTAATCTGTACGATTCCCATAACCGTCAACTTAGTAAATATTTTT
TRN  10010101100011000
NAM  Q97GD2_CLOAB/136-380
ASQ  KFIFGLVAVFIILLSVVGG.KKGVKSVIALAIT-AVAVLKIMIPLIIAGFNPTIVSIVICIVVSTINLIIISGKNKKTLAAIIGTSGGLILSALIATFSIITLRLSGLTDEEEQMVIYITQNTSFNFSGLLFAGILMGALGAVMDIGMSIASSINELHETND....KATVMELVKSGMNVGRDMMGTMANTLILAYAGGAMY..VMIWISSYDLPLYRIINQDVIASELVKTLAGSIGLIFTIPLTAFCSAMI
DSQ  AAATTTATTTTCGGACTCGTGGCAGTATTTATAATACTTCTCAGTGTAGTTGGAGGT...AAAAAGGGAGTGAAATCTGTAATTGCCCTTGCTATAACA---GCTGTTGCAGTATTAAAGATAATGATTCCTCTTATAATTGCTGGTTTTAACCCTACTATTGTTTCAATTGTAATATGTATAGTTGTAAGTACAATAAATCTTATAATTATAAGTGGGAAGAACAAAAAAACTCTTGCAGCTATTATAGGTACAAGTGGAGGGCTTATACTGTCAGCATTAATTGCTACCTTTAGTATAATTACTTTAAGGTTGTCAGGACTGACCGATGAGGAAGAACAAATGGTTATTTATATTACTCAAAATACAAGCTTTAATTTTAGCGGACTATTATTTGCAGGAATATTAATGGGAGCCTTAGGTGCCGTAATGGATATTGGTATGTCAATAGCTTCATCAATAAACGAACTGCATGAGACCAATGAT............AAGGCAACTGTTATGGAGCTTGTAAAGTCTGGAATGAATGTTGGAAGAGATATGATGGGAACAATGGCTAATACACTTATTTTGGCATATGCAGGAGGGGCTATGTAT......GTTATGATATGGATTTCATCATATGATCTTCCTCTGTATAGAATTATAAATCAAGATGTAATAGCTTCGGAGCTTGTTAAAACATTAGCTGGAAGTATTGGTTTAATATTTACAATACCTCTTACAGCTTTTTGTTCTGCAATGATA
TRN  10010101100011000
NAM  Q72J55_THET2/80-321
ASQ  PWLAALALLFALGAVGLGR.GKGLRGLLGTLFG-LLLLVYVVVPRIAAGGDPLLHAFLGSLGVLVLSVYFVHGLGRKTTAALGATLAAVLLVLLLGRFFAQAMGFTGLASEEALLLHQ---WGGVDLLGLYLAGLAVGALGALADVTVTQASVVQALAHADP....QAPPWRLYRRAMEVGYDHLGSLVNTLVLAYAAGSLP..LFLLLTRDPTPLRFLLNTEPFAAELVGMLLGSLGLVLAVPLSTLFAAFL
DSQ  CCCTGGCTCGCCGCCTTGGCCCTTCTCTTCGCCCTGGGGGCGGTGGGGCTCGGCCGG...GGCAAGGGGCTTAGGGGGCTTTTGGGGACCCTCTTCGGC---TTGCTCCTCCTGGTCTACGTCGTCGTCCCCCGGATCGCCGCCGGGGGGGATCCCTTGCTCCACGCCTTCCTCGGAAGCCTCGGGGTCCTCGTCCTCAGCGTCTACTTCGTCCACGGCCTCGGCCGCAAGACCACCGCCGCCTTGGGGGCCACCCTGGCCGCGGTCCTCCTCGTCCTCCTCTTGGGGCGGTTCTTCGCCCAGGCCATGGGCTTCACGGGGCTTGCCTCCGAGGAGGCCCTCCTCCTCCACCAG---------TGGGGGGGCGTGGACCTTTTGGGGCTCTACCTGGCGGGGCTCGCCGTGGGGGCCCTCGGGGCCTTGGCCGACGTGACCGTGACCCAGGCCAGCGTGGTCCAGGCCCTGGCCCACGCCGACCCC............CAGGCCCCCCCCTGGCGCCTTTACCGGCGGGCCATGGAGGTGGGGTACGACCACCTGGGGAGCCTGGTGAACACCCTGGTCCTGGCCTACGCCGCGGGAAGCCTTCCC......CTCTTCCTCCTCCTCACCCGGGACCCCACGCCCCTGCGCTTCCTCCTCAACACCGAGCCCTTCGCCGCCGAGCTCGTGGGCATGCTCCTCGGGTCCTTGGGGCTCGTGCTCGCGGTCCCCCTCTCCACCCTCTTCGCCGCCTTTCTG
TRN  10010101100011011
NAM  Q82FI6_STRAW/211-453
ASQ  FPMALLAGIFALAVVVVGR.MRGVMALVALAIS-FMVLTLFILPAILEGSNPLIVAVVGASAIMLIALYMCHGLSARTSVAVLGTLLSLVLIGLLGSQFIGWAALTGNTDDNTGLIHGL--YPHIDMSGLLLAGVIIGSLGVLDDVTVTQTSAVWELHEANP....TMGWRGLYRAGIRIGRDHIASVVNTLVLAYAGAALP..LLLLFSIAQSSVGTVANSELVAEEIVRTLVGSIGLVASVPVTTALAALV
DSQ  TTCCCCATGGCTTTGCTCGCCGGCATCTTCGCACTCGCCGTCGTCGTCGTGGGCCGG...ATGCGCGGCGTCATGGCGCTGGTCGCGCTGGCCATCAGC---TTCATGGTGCTGACCTTGTTCATCCTGCCCGCGATCCTGGAGGGCTCGAATCCACTGATCGTGGCGGTGGTCGGGGCGAGCGCCATCATGTTGATCGCGCTCTACATGTGTCACGGTCTTTCAGCCCGGACATCGGTGGCCGTACTGGGCACGCTGCTCTCGTTGGTGCTGATCGGCCTGCTCGGCTCACAGTTCATCGGCTGGGCCGCGCTGACCGGCAACACGGACGACAACACTGGCCTGATCCACGGCCTG------TACCCGCACATCGACATGAGTGGTCTGCTGCTGGCGGGCGTGATCATCGGTTCCCTCGGTGTTCTCGACGACGTGACGGTCACTCAGACGTCGGCGGTATGGGAGCTGCACGAGGCCAATCCG............ACGATGGGCTGGCGCGGTCTGTATCGCGCGGGCATCCGCATCGGCCGCGACCACATCGCGTCGGTCGTCAACACGTTGGTCCTGGCGTATGCGGGTGCCGCCCTGCCC......CTGCTGCTCCTCTTCTCGATCGCGCAGAGCAGCGTCGGCACGGTCGCCAACAGCGAACTGGTCGCCGAGGAGATCGTCCGCACACTCGTCGGCTCGATCGGCCTGGTCGCCTCTGTTCCCGTCACCACGGCCCTGGCCGCCCTGGTG
TRN  11011111101111101
NAM  Q73T89_MYCPA/163-403
ASQ  WALVGLAVAFAVVIVAVAR.WRGLLALVGILVA-FVVLVTFLLPALRDGAPAVPVALVAAVAILYAVIYLAHGVSLRTSAALLGTLSSLLLAAGLSWAAIQLAHLTGLSDEQNSTVSAY--LGSVSIGGLLLAGFIIGSLGVLNDVTVTQSSTVFELARLGG....--SRRAIFTGALRVGRDHIASTVYTLVLAYAGSSLP..LLLLFSVANRSLTDVLTGESVAIEIARSAVGGMALALSVPLTTAIAAVL
DSQ  TGGGCGCTGGTCGGTTTGGCGGTCGCGTTCGCGGTGGTGATCGTCGCGGTGGCGCGC...TGGCGCGGACTGCTGGCGCTGGTGGGCATCCTGGTCGCC---TTCGTGGTGCTGGTGACGTTCCTGCTGCCGGCGCTGCGCGACGGCGCGCCCGCGGTCCCGGTGGCGCTGGTGGCGGCGGTGGCGATCCTCTACGCGGTCATCTACCTGGCCCACGGCGTCAGCCTGCGCACCAGCGCCGCGCTGCTGGGCACCCTGTCGTCGTTGCTGCTTGCCGCCGGATTATCCTGGGCAGCAATACAATTGGCGCATCTCACCGGGCTCTCGGATGAACAGAACAGCACGGTCAGCGCGTAC------CTCGGCAGCGTGTCCATCGGCGGGCTGCTGCTGGCCGGTTTCATCATCGGCTCGCTGGGTGTGCTCAACGACGTGACGGTGACCCAGTCCTCGACGGTGTTCGAGCTGGCCCGCCTGGGCGGC............------TCGCGGCGGGCGATCTTCACCGGCGCCCTGCGGGTGGGCCGCGATCACATCGCCAGCACCGTCTACACGCTGGTGCTGGCCTATGCCGGCAGTTCGCTGCCG......CTGCTGCTGCTGTTCAGCGTCGCCAACCGCTCGCTGACCGACGTGCTGACCGGCGAGAGCGTGGCCATCGAGATCGCCCGCTCGGCGGTCGGCGGCATGGCGCTGGCCCTGTCGGTGCCGTTGACCACGGCGATCGCCGCGGTGCTG
TRN  10010111100111010
NAM  Q6NEX2_CORDI/137-379
ASQ  SSLLIWGALIAASIVALAA.TRGLRSLVGLAFT-MAVVAMFTLPALLVGASPTGVAIVSGALILIPVLFVVHGLNWKSAAALGGTLLALLIAAGLSYWAIEHNQLRGLGNEDNLQIILY--LPGVSVTGLMLCGFIIGALGVLNDVTIAQASTVNELAEQNP....TATRWQWFTSAMKVGRDHIASMVYTLVLSYTGATLP..LLLLLSVAHRPLAQTLTSDVMATELLRSGLGAMALTLAVPLTTIVAAWT
DSQ  TCGTCGCTGCTGATCTGGGGCGCGCTGATTGCGGCGTCGATAGTTGCGTTGGCGGCG...ACGCGTGGTTTGCGTTCGTTGGTGGGCTTGGCGTTTACC---ATGGCGGTTGTTGCGATGTTTACGCTGCCGGCGTTGTTGGTGGGGGCGTCTCCGACAGGGGTGGCGATTGTCAGCGGCGCACTGATTCTGATCCCCGTGTTATTTGTGGTCCATGGCCTGAATTGGAAGTCTGCCGCGGCGCTGGGCGGAACGTTGCTGGCGTTGCTGATTGCTGCGGGCTTATCTTATTGGGCGATTGAGCATAATCAGCTGCGTGGCTTGGGCAATGAGGACAACCTACAGATTATTTTGTAT------CTGCCTGGGGTGTCGGTAACTGGCCTCATGCTGTGTGGGTTCATTATCGGCGCACTAGGTGTGCTCAACGATGTGACGATTGCGCAGGCGTCGACAGTCAATGAGCTGGCAGAGCAAAACCCG............ACGGCAACACGTTGGCAGTGGTTTACCTCGGCAATGAAGGTGGGCCGTGACCATATTGCGTCGATGGTGTACACGCTGGTGTTGTCCTACACCGGCGCCACGCTGCCG......CTGTTGTTGCTGCTGTCGGTGGCGCATCGTCCGCTGGCGCAAACTCTCACTAGCGATGTGATGGCTACTGAGCTGTTGCGCTCTGGTTTGGGCGCGATGGCGCTTACTCTTGCAGTGCCGCTGACCACAATTGTGGCTGCGTGGACT
TRN  10010111100111010
NAM  Q8FU88_COREF/158-400
ASQ  STLLVWAVVIALTIILFAA.WRGVRALGGLVVT-FAGIALFLLPSLARGEDALALAIVTGAAILIVVVPLVHGVNWKSASALGGTLIALGIAALLAHVAIDSTDLRGLGSQDNLNILVY--LPEVSILGLMLCGFIIGTLGVLNDVTISQSSTVNELAQLDP....QASPWRLFIGAMKVGRDHISSMVYTLVLSYTGAALP..LLLLLSVANRPLSQILTSDIMATELLRSGVGALALTLAVPLTTLIAAWT
DSQ  TCCACCCTGCTGGTGTGGGCAGTGGTCATCGCCCTGACCATCATCCTCTTCGCCGCA...TGGCGGGGTGTCCGTGCACTGGGAGGACTGGTGGTCACC---TTTGCCGGCATCGCATTGTTCCTCCTCCCCTCCCTGGCCCGGGGGGAAGATGCCCTCGCCCTCGCCATTGTCACCGGTGCCGCCATCCTCATCGTGGTGGTACCCCTGGTTCACGGGGTGAATTGGAAATCAGCCTCCGCATTGGGCGGCACCCTCATCGCGCTGGGCATCGCCGCGCTGTTGGCGCACGTGGCGATCGACAGCACTGATCTCCGGGGCCTGGGTTCCCAGGACAACCTCAACATCCTGGTCTAC------CTGCCGGAGGTCTCGATTCTGGGGTTGATGCTGTGCGGGTTCATCATCGGCACCCTCGGTGTACTCAACGATGTCACCATCTCCCAGTCCTCCACCGTCAATGAACTCGCCCAGCTGGATCCG............CAGGCCAGCCCCTGGCGACTGTTCATCGGGGCGATGAAGGTGGGCCGGGACCATATCTCCTCCATGGTCTACACCCTGGTGTTGTCCTATACCGGTGCGGCCCTCCCA......CTGTTGCTATTACTGAGTGTGGCCAATCGTCCCCTGTCACAGATCCTGACCAGTGACATCATGGCCACAGAACTATTACGCTCCGGGGTTGGCGCCCTGGCACTGACTCTGGCAGTGCCGCTGACCACTCTAATCGCGGCCTGGACG
TRN  11011101101011000
NAM  Q8NLU1_CORGL/158-400
ASQ  PALIIWGVVLIVAMGAFAA.WRGVRALVGLVVT-LGIVGIFLLPGLASGHDAMWLALVCGAAILLIVVPMVHGINWKSAAALAGTLVALLLSAVLSWASIVTTNLRGLGDENHLKIINY--LPEVSISGLLLASFIIGTLGVLNDVTISQASTINELAEIDE....DATPWRLFTGAMSVGRDHISSMIYTLVLGYTGAALP..LLLLLSLAERPLIQTLSSDVMAGELLRSGVGALTLTLAVPITTLIAAWT
DSQ  CCGGCGTTGATCATTTGGGGTGTGGTTCTCATTGTGGCGATGGGAGCTTTCGCGGCG...TGGCGAGGTGTGCGTGCGCTGGTTGGTTTGGTCGTCACC---TTGGGAATTGTTGGTATTTTCTTGCTGCCAGGATTGGCCAGCGGGCACGATGCGATGTGGTTGGCGCTGGTGTGTGGCGCGGCGATCTTGTTGATTGTGGTGCCGATGGTTCACGGAATCAACTGGAAATCGGCAGCTGCGTTGGCGGGCACGCTGGTGGCATTGTTGTTGTCGGCGGTGTTGTCGTGGGCGTCGATCGTCACCACGAATTTGCGCGGACTGGGCGATGAGAATCATCTGAAGATCATCAACTAT------TTGCCGGAGGTGTCGATCTCTGGGTTGCTGTTGGCATCGTTCATCATTGGTACCTTGGGTGTGCTCAACGATGTGACGATCTCACAGGCGTCGACCATCAATGAGCTCGCGGAAATCGATGAA............GATGCCACACCGTGGAGGCTGTTTACCGGCGCGATGTCGGTTGGTCGCGACCACATTTCCTCAATGATTTACACCCTGGTGTTGGGCTACACCGGCGCAGCTTTGCCA......CTGTTGCTGCTGCTTTCCTTGGCAGAGCGTCCGCTGATTCAGACTCTGAGCAGCGATGTTATGGCCGGCGAGCTGCTGCGTTCAGGTGTCGGTGCGCTGACGTTGACACTGGCGGTGCCGATCACGACGCTGATCGCCGCATGGACG
TRN  10010101100011001
NAM  Q9CHC5_LACLA/140-381
ASQ  ALIVGLLVLFIGFVISFERfRASIFLFLSLVLN-LLYFVIVIALNVEFNPPVILLFGILSVIFAASSLLFVLGPTKQMLYTFITTVLTTALTFSIVLFVLKMTGNSGIHFEYLD-------YVTQNPSEFFFVGTMISVLGAIMDGTGDIVAGLFGMARQNKlnkiNMVRKDYIKSGISIGQELIGTLTNVLFMIFMAETLP..MTLLLLRNGNSWSYIATVG-LNLGLLQTIISAIGIVLAVPITAVFTSFA
DSQ  GCACTAATTGTTGGACTACTCGTTTTATTTATTGGTTTTGTCATTAGTTTTGAACGAtttAGAGCTTCAATTTTTCTTTTCTTATCTCTGGTCTTAAAC---CTTCTTTACTTTGTGATTGTCATCGCCCTTAACGTTGAATTTAATCCACCTGTCATTTTGCTATTTGGGATTCTGTCAGTAATTTTTGCAGCTTCCTCCCTTTTATTTGTCTTGGGACCCACAAAACAGATGCTCTATACTTTTATAACTACCGTATTAACCACTGCTTTAACTTTTTCAATTGTTTTATTCGTTCTAAAAATGACAGGGAATTCGGGTATTCATTTTGAATACTTGGAC---------------------TATGTCACCCAAAATCCATCAGAGTTTTTCTTTGTTGGGACAATGATTTCAGTTTTAGGGGCAATCATGGATGGTACAGGTGATATTGTTGCAGGGCTTTTTGGTATGGCTAGACAAAATAAAttgaacaaaataAATATGGTCAGAAAAGATTACATTAAATCAGGAATTTCAATTGGGCAAGAGCTCATTGGAACTTTGACAAATGTTTTGTTCATGATTTTCATGGCGGAAACTTTGCCG......ATGACGCTTTTATTATTGAGAAATGGAAATTCTTGGTCTTATATTGCAACGGTTGGT---CTTAATCTTGGGTTATTACAAACAATTATTTCGGCCATTGGAATCGTGTTAGCTGTGCCAATTACCGCTGTTTTCACAAGTTTTGCT
TRN  10010101100011000
NAM  Q88Y30_LACPL/172-409
ASQ  TALAFVAWLALALLLLIMR.FSGLMAFLSVALNAVLFYAAIQIDLATNGDHIYLLFGVLAVIFAVLTLLLVLGFSRQMLVTLGATVVGTGLAVIISLIVFAVTHERGVTYESMQ-------YVTQVPRPLFLVETVLGSLGAVMDESTDIVASLFQLKTERP....DIAPRQVFKSGIQIGRSIMGPLINVLFLIFMADTFA..MTLLYFRNGNSWGYTFTMN-MSLGMVQSLISGIGIVLAIPVASWLASRL
DSQ  ACCGCCTTGGCGTTTGTCGCGTGGTTAGCCCTAGCACTGCTCTTGTTAATCATGCGT...TTCAGTGGTCTGATGGCCTTTTTGAGTGTCGCGCTCAACGCTGTACTATTTTATGCCGCCATTCAGATCGATTTAGCTACTAATGGTGACCACATTTACCTGCTCTTTGGCGTATTGGCCGTAATCTTCGCCGTGCTCACACTGTTGCTAGTGCTCGGTTTTAGTCGTCAAATGTTAGTAACATTGGGCGCGACTGTGGTTGGCACGGGACTGGCTGTCATTATTAGTCTGATCGTCTTTGCGGTGACCCATGAGCGTGGTGTGACTTATGAATCGATGCAG---------------------TACGTGACGCAAGTTCCCCGACCGTTATTTTTAGTCGAAACAGTCCTCGGTTCACTCGGAGCAGTCATGGATGAATCAACAGATATTGTTGCTTCATTGTTTCAATTGAAAACGGAGCGCCCG............GACATTGCACCACGACAAGTATTTAAGTCGGGTATTCAAATTGGCCGGTCTATTATGGGGCCCTTGATCAACGTGCTATTTTTGATTTTCATGGCGGATACTTTCGCG......ATGACTTTGCTCTATTTCCGTAACGGCAATAGCTGGGGTTACACTTTTACAATGAAT---ATGTCGTTGGGGATGGTCCAAAGTTTGATTTCTGGTATCGGTATCGTTTTAGCGATTCCAGTAGCCAGTTGGTTAGCCAGTCGATTG
TRN  11011101101011000
//