EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07875 - Coat_F)
FAM  PF07875
PID  Coat_F
DES  Coat F domain
ANO  17
ALN  65
AID  0.271073
APH  (((((((((Q97LE8_CLOAB/14-78:0.20256,Q9KEV6_BACHD/14-78:0.37572):0.08650,O07949_BACSU/17-81:0.49816):0.10011,O06010_BACSU/14-78:0.31642):0.29147,(COTF_BACSU/77-141:0.11102,Q6HGX9_BACHK/76-140:0.26661):0.41621):0.32172,(Q97FG0_CLOAB/15-79:0.72932,(Q8R816_THETN/7-71:0.87148,Q97FP5_CLOAB/8-72:0.52369):0.27351):0.07457):0.05470,((Q6HBQ7_BACHK/1-65:0.24790,Q8XNS8_CLOPE/1-65:0.45433):0.27898,Q8ES15_OCEIH/2-66:0.11253):0.69175):0.33536,(O69144_CLOPA/101-165:0.20734,Q6HJS4_BACHK/81-145:1.05592):0.45501):1.10614,YHCQ_BACSU/120-184:0.24157):0.14063,Q8ELM4_OCEIH/129-193:0.32487,Q9K644_BACHD/132-196:0.13676);
ATP  (((((((((Q97LE8_CLOAB/14-78,Q9KEV6_BACHD/14-78),O07949_BACSU/17-81),O06010_BACSU/14-78),(COTF_BACSU/77-141,Q6HGX9_BACHK/76-140)),(Q97FG0_CLOAB/15-79,(Q8R816_THETN/7-71,Q97FP5_CLOAB/8-72))),((Q6HBQ7_BACHK/1-65,Q8XNS8_CLOPE/1-65),Q8ES15_OCEIH/2-66)),(O69144_CLOPA/101-165,Q6HJS4_BACHK/81-145)),YHCQ_BACSU/120-184),Q8ELM4_OCEIH/129-193,Q9K644_BACHD/132-196);
ATL  11.3553
DNO  17
DLN  195
DID  0.420626
DPH  ((Q97LE8_CLOAB/14-78:0.22525,(O06010_BACSU/14-78:0.25722,O07949_BACSU/17-81:0.42838):0.10676):0.00695,(((Q6HGX9_BACHK/76-140:0.23367,COTF_BACSU/77-141:0.25947):0.15918,((Q9K644_BACHD/132-196:0.15662,Q8ELM4_OCEIH/129-193:0.29515):0.18229,YHCQ_BACSU/120-184:0.17416):0.65533):0.15714,(((Q6HJS4_BACHK/81-145:0.62092,O69144_CLOPA/101-165:0.27016):0.30383,((Q8XNS8_CLOPE/1-65:0.33022,Q6HBQ7_BACHK/1-65:0.18243):0.08265,Q8ES15_OCEIH/2-66:0.23357):0.31939):0.07728,((Q97FP5_CLOAB/8-72:0.31007,Q8R816_THETN/7-71:0.64243):0.16735,Q97FG0_CLOAB/15-79:0.42163):0.12026):0.22414):0.13788,Q9KEV6_BACHD/14-78:0.33750);
DTP  ((Q97LE8_CLOAB/14-78,(O06010_BACSU/14-78,O07949_BACSU/17-81)),(((Q6HGX9_BACHK/76-140,COTF_BACSU/77-141),((Q9K644_BACHD/132-196,Q8ELM4_OCEIH/129-193),YHCQ_BACSU/120-184)),(((Q6HJS4_BACHK/81-145,O69144_CLOPA/101-165),((Q8XNS8_CLOPE/1-65,Q6HBQ7_BACHK/1-65),Q8ES15_OCEIH/2-66)),((Q97FP5_CLOAB/8-72,Q8R816_THETN/7-71),Q97FG0_CLOAB/15-79))),Q9KEV6_BACHD/14-78);
DTL  8.07928
RID  0.271073
RPH  (((((((((Q97LE8_CLOAB/14-78:0.20256,Q9KEV6_BACHD/14-78:0.37572):0.08650,O07949_BACSU/17-81:0.49816):0.10011,O06010_BACSU/14-78:0.31642):0.29147,(COTF_BACSU/77-141:0.11102,Q6HGX9_BACHK/76-140:0.26661):0.41621):0.32172,(Q97FG0_CLOAB/15-79:0.72932,(Q8R816_THETN/7-71:0.87148,Q97FP5_CLOAB/8-72:0.52369):0.27351):0.07457):0.05470,((Q6HBQ7_BACHK/1-65:0.24790,Q8XNS8_CLOPE/1-65:0.45433):0.27898,Q8ES15_OCEIH/2-66:0.11253):0.69175):0.33536,(O69144_CLOPA/101-165:0.20734,Q6HJS4_BACHK/81-145:1.05592):0.45501):1.10614,YHCQ_BACSU/120-184:0.24157):0.14063,Q8ELM4_OCEIH/129-193:0.32487,Q9K644_BACHD/132-196:0.13676);
RTP  (((((((((Q97LE8_CLOAB/14-78,Q9KEV6_BACHD/14-78),O07949_BACSU/17-81),O06010_BACSU/14-78),(COTF_BACSU/77-141,Q6HGX9_BACHK/76-140)),(Q97FG0_CLOAB/15-79,(Q8R816_THETN/7-71,Q97FP5_CLOAB/8-72))),((Q6HBQ7_BACHK/1-65,Q8XNS8_CLOPE/1-65),Q8ES15_OCEIH/2-66)),(O69144_CLOPA/101-165,Q6HJS4_BACHK/81-145)),YHCQ_BACSU/120-184),Q8ELM4_OCEIH/129-193,Q9K644_BACHD/132-196);
RTL  11.3553
LNK  COTF_BACSU/77-141:P23261:M58592
LNK  O06010_BACSU/14-78:O06010:X92868
LNK  O07949_BACSU/17-81:O07949:X92868
LNK  O69144_CLOPA/101-165:O69144:AF064550
LNK  Q6HBQ7_BACHK/1-65:Q6HBQ7:AE017355
LNK  Q6HGX9_BACHK/76-140:Q6HGX9:AE017355
LNK  Q6HJS4_BACHK/81-145:Q6HJS4:AE017355
LNK  Q8ELM4_OCEIH/129-193:Q8ELM4:BA000028
LNK  Q8ES15_OCEIH/2-66:Q8ES15:BA000028
LNK  Q8R816_THETN/7-71:Q8R816:AE013167
LNK  Q8XNS8_CLOPE/1-65:Q8XNS8:BA000016
LNK  Q97FG0_CLOAB/15-79:Q97FG0:AE007775
LNK  Q97FP5_CLOAB/8-72:Q97FP5:AE007766
LNK  Q97LE8_CLOAB/14-78:Q97LE8:AE007577
LNK  Q9K644_BACHD/132-196:Q9K644:BA000004
LNK  Q9KEV6_BACHD/14-78:Q9KEV6:BA000004
LNK  YHCQ_BACSU/120-184:P54601:X96983
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KEV6_BACHD/14-78
ASQ  MTDQVVATDMLIAAKAGIKNIATAISESATPEVRAALQQQLDQQIRFHGQMTEYMMKNGYYHPYN
DSQ  ATGACAGATCAGGTCGTGGCAACCGATATGCTCATTGCTGCAAAAGCAGGAATTAAAAATATTGCGACCGCGATCTCAGAATCTGCAACACCAGAGGTTCGGGCTGCACTCCAACAGCAACTTGACCAACAAATCCGTTTTCACGGTCAAATGACCGAATACATGATGAAAAACGGTTACTACCATCCATATAAT
TRN  11011101111011001
NAM  Q97LE8_CLOAB/14-78
ASQ  LNDHVVATDFLISTKSGVKNYAVAITETATPRVRAILRKHLDEGINCHEKILNYMMTNGYYHPYN
DSQ  CTTAATGATCACGTCGTGGCAACAGACTTCTTAATTTCAACTAAGTCTGGAGTAAAAAACTATGCTGTAGCTATAACTGAAACAGCTACACCTAGAGTAAGAGCTATTTTAAGGAAACATCTTGATGAAGGTATAAACTGCCACGAAAAAATATTGAACTACATGATGACAAACGGTTATTACCATCCCTATAAT
TRN  10010101110011000
NAM  O06010_BACSU/14-78
ASQ  LTDQIIAMDLLISAKNGVRNYAMAATEAGTPEVKEVLIRHLEEALDMHEQLSSYMMEKGWYHPWN
DSQ  CTAACAGACCAAATCATTGCTATGGACTTATTAATTTCAGCAAAGAACGGAGTCAGAAATTATGCGATGGCAGCCACTGAAGCCGGAACGCCTGAAGTAAAAGAGGTCCTTATCCGCCATTTGGAAGAAGCACTCGATATGCACGAACAACTCTCAAGCTATATGATGGAAAAAGGCTGGTACCATCCTTGGAAC
TRN  10010101110011000
NAM  O07949_BACSU/17-81
ASQ  LADTTFAMDFLIRAKEGVRNTAVALTETASPDVRALLRKQLMQGIAMHQEITELMISKKWFHPYE
DSQ  CTAGCAGACACTACATTCGCGATGGATTTTCTTATACGAGCTAAGGAAGGCGTAAGGAATACTGCTGTAGCTTTGACAGAAACCGCTTCACCAGATGTAAGAGCACTGCTTCGGAAACAGCTGATGCAAGGAATTGCGATGCACCAAGAGATTACGGAACTGATGATCAGCAAAAAGTGGTTCCATCCATATGAG
TRN  10010101100011001
NAM  Q6HGX9_BACHK/76-140
ASQ  DDTGFYAGDLLGLAKTSVRNYAIAITETATPRLREVLTRQINGAIQLHAQVFNFMYERGYYPAYD
DSQ  GATGACACTGGATTTTACGCTGGAGATTTACTTGGATTAGCAAAGACATCTGTTCGAAACTATGCAATAGCGATTACCGAAACTGCAACGCCGCGACTTAGAGAAGTTTTAACCCGTCAAATAAATGGAGCTATACAATTACATGCACAGGTTTTTAACTTTATGTATGAACGTGGTTACTATCCAGCTTATGAT
TRN  10010101110011010
NAM  COTF_BACSU/77-141
ASQ  ADNPFYSGDLLGFAKTSVRSYAIAITETATPQLRNVLVKQLNAAIQLHAQVYRYMYQHGYYPSYN
DSQ  GCAGATAACCCATTTTACAGCGGTGACCTGCTCGGTTTTGCCAAAACATCTGTCCGCAGCTATGCCATCGCAATTACAGAAACAGCAACACCTCAATTAAGAAACGTACTGGTCAAACAGCTGAATGCTGCCATCCAGCTGCACGCCCAAGTTTATCGATACATGTATCAGCATGGATATTATCCGTCTTACAAC
TRN  10010101100011010
NAM  Q9K644_BACHD/132-196
ASQ  VSDQGISGHMLGLMKSQATMLTTASLEATNPVVRRVLADSVPNVVEMAYELFLYQNQHAYYQVPQ
DSQ  GTTTCTGACCAAGGAATTTCCGGTCATATGCTTGGATTAATGAAATCACAGGCAACCATGCTGACGACAGCTTCCTTAGAGGCAACCAATCCTGTCGTTCGCCGGGTGCTTGCTGACAGTGTACCAAATGTGGTCGAAATGGCGTATGAGCTTTTCCTTTACCAAAACCAACATGCCTATTATCAAGTACCACAA
TRN  11011101101011000
NAM  Q8ELM4_OCEIH/129-193
ASQ  LSDQGISAYMLGNAKSLTSLLAMTAVEMTNPVLRRVIADTVPNFIELSYEIFLYQNKHAYYQVPQ
DSQ  CTATCGGATCAAGGAATCTCCGCCTATATGCTAGGAAATGCTAAGTCACTAACATCTTTGCTGGCGATGACAGCAGTCGAGATGACCAACCCCGTATTACGTAGAGTAATTGCTGACACAGTACCAAATTTTATTGAGCTTAGCTACGAGATTTTCTTATATCAAAATAAACACGCATATTATCAAGTTCCTCAA
TRN  10010101100011000
NAM  YHCQ_BACSU/120-184
ASQ  IDDSIISRQMLCAIKAQASMLTMASLEMTNPAVRRVLSAQIQEYVEMAFEIFLYQNKHGYYQVPQ
DSQ  ATTGATGACAGCATCATCAGCCGACAAATGCTTTGCGCGATTAAAGCACAAGCTTCTATGCTGACGATGGCTTCTCTGGAAATGACAAATCCGGCCGTAAGACGCGTACTGTCTGCGCAAATTCAGGAGTATGTTGAAATGGCATTTGAAATTTTCCTATACCAAAACAAACACGGCTATTACCAGGTTCCTCAG
TRN  10010101100011011
NAM  Q6HJS4_BACHK/81-145
ASQ  TGDMYIATCYISHLKRLALKFAQVAVEVANPEFRSFLENCFLKMNRYAYSVWQYVVKKEYKIKHV
DSQ  ACAGGGGATATGTATATTGCAACTTGTTATATTTCGCATTTAAAACGGTTAGCGTTAAAGTTTGCTCAAGTGGCAGTTGAAGTTGCAAATCCAGAATTCCGCTCGTTTTTAGAAAACTGTTTCCTGAAAATGAATCGATATGCCTATAGTGTATGGCAATATGTCGTCAAGAAAGAGTATAAGATTAAACATGTA
TRN  11011101101011010
NAM  O69144_CLOPA/101-165
ASQ  MNDREIATAYLLTLKRAGREYAWSAMETGNPEIRQFLKDAFTMSCNHAYDVWQWMVQKGYYPLSP
DSQ  ATGAATGATAGAGAAATAGCTACTGCCTATCTTTTAACATTAAAAAGAGCAGGTAGAGAATATGCTTGGAGTGCTATGGAAACTGGTAATCCTGAAATAAGACAATTTCTAAAAGATGCATTTACAATGAGTTGTAATCATGCTTACGACGTATGGCAGTGGATGGTACAAAAGGGATATTATCCTCTATCACCA
TRN  10010101110011000
NAM  Q97FP5_CLOAB/8-72
ASQ  MTEKDLIEDILSSEKQLISSYSSGITESSCKNLRNVLVNNLKCSEETQYRAFDTMKQKGWYPTKD
DSQ  ATGACTGAAAAGGATTTAATTGAAGATATTTTATCTTCTGAAAAACAATTAATATCATCTTACAGTTCAGGAATTACAGAATCTTCTTGTAAAAATTTAAGAAATGTATTAGTCAATAATCTTAAATGCAGCGAAGAAACACAGTACAGGGCTTTTGATACTATGAAACAAAAAGGTTGGTACCCTACTAAGGAT
TRN  10010101110011000
NAM  Q8R816_THETN/7-71
ASQ  VTDKEIMMNILGSYKLAIEMLSHAAVEAANESIRREYINLLNSTLEDQRTVWTAVNQRGWYPVKA
DSQ  GTTACTGATAAAGAGATAATGATGAATATTCTGGGAAGTTATAAGCTAGCTATAGAGATGCTAAGCCACGCAGCAGTAGAAGCTGCCAATGAGAGCATAAGAAGGGAGTATATAAACCTCTTAAATTCAACTTTGGAAGACCAGAGGACAGTCTGGACTGCAGTAAACCAGAGGGGATGGTATCCTGTTAAGGCT
TRN  10010101100011000
NAM  Q97FG0_CLOAB/15-79
ASQ  LTNKDIASDFMMNLDDFIVSLSTATCQTMNPQLRQVFDAQLISAINNQHNLSDMMVKKSWYPAFD
DSQ  CTTACAAATAAAGATATAGCGTCAGATTTTATGATGAATTTAGATGATTTTATAGTTTCTTTATCTACTGCTACTTGTCAAACTATGAACCCACAATTAAGACAGGTATTTGATGCTCAACTTATTTCAGCTATAAATAATCAACATAATCTTTCAGATATGATGGTAAAAAAATCTTGGTATCCAGCATTTGAT
TRN  10010101110011000
NAM  Q8XNS8_CLOPE/1-65
ASQ  MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDEVRQYALFKIAKEKGYYIPAQ
DSQ  ATGCAAGAAAAAGAAATGATAAGCGATTATCTTGCTGGAATAAATGCAAGTTTAGCAGGATATGGTGGTATAATTTCTCAATGTGAGAATCAAGAATTAAGAGAAACTATACAAAACATGAGAAACCAAGATGAAGTACGTCAATATGCTCTTTTCAAAATTGCAAAAGAAAAAGGATACTATATCCCTGCTCAA
TRN  10010101110011010
NAM  Q8ES15_OCEIH/2-66
ASQ  LQDKDIVNDYLNGLNASMKSYAGYITEANNPELRQKLVSLRNGDEARQLSVYQYAIQKGHYKPAQ
DSQ  TTACAGGATAAAGATATTGTAAATGATTATTTAAATGGGTTAAATGCAAGTATGAAAAGTTATGCTGGTTATATTACCGAGGCAAATAATCCAGAACTGCGTCAAAAATTAGTTAGTCTCCGTAATGGTGACGAGGCAAGACAGCTAAGCGTATATCAATATGCAATACAAAAAGGTCACTATAAACCTGCACAG
TRN  10010101100011010
NAM  Q6HBQ7_BACHK/1-65
ASQ  MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAA
DSQ  ATGAATGAAAAAGATATGGTAAATGATTATTTAGCAGGATTAAATGCAAGTTTAACAAGTTATGCAAATTATATTGCTCAGTCTGATAATGAACAGTTACACCAAACGTTAATCCAAATTCGTAATCAAGATGAAATGCGCCAACGTAATATGTATGAGTATGCAAAGCAAAAGAGTTATTACAAACCGGCAGCA
TRN  11111101111011010
//