EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07858 - LEH)
FAM  PF07858
PID  LEH
DES  Limonene-1,2-epoxide hydrolase catalytic domain
ANO  7
ALN  127
AID  0.338421
APH  ((Q73W09_MYCPA/9-129:0.00096,(O33283_MYCTU/15-135:0.27333,Q49850_MYCLE/43-164:0.43903):0.14259):0.63617,(Q9A482_CAUCR/6-128:0.73523,(Q8XW86_RALSO/2-128:0.15450,Q8XW85_RALSO/2-128:0.39648):1.04317):0.19202,LIMA_RHOER/21-144:1.06329);
ATP  ((Q73W09_MYCPA/9-129,(O33283_MYCTU/15-135,Q49850_MYCLE/43-164)),(Q9A482_CAUCR/6-128,(Q8XW86_RALSO/2-128,Q8XW85_RALSO/2-128)),LIMA_RHOER/21-144);
ATL  5.07677
DNO  7
DLN  381
DID  0.463433
DPH  ((Q9A482_CAUCR/6-128:0.49903,(Q8XW86_RALSO/2-128:0.17403,Q8XW85_RALSO/2-128:0.36545):0.48286):0.11093,((Q73W09_MYCPA/9-129:0.07990,Q49850_MYCLE/43-164:0.37785):0.07215,O33283_MYCTU/15-135:0.10141):0.30937,LIMA_RHOER/21-144:0.64899);
DTP  ((Q9A482_CAUCR/6-128,(Q8XW86_RALSO/2-128,Q8XW85_RALSO/2-128)),((Q73W09_MYCPA/9-129,Q49850_MYCLE/43-164),O33283_MYCTU/15-135),LIMA_RHOER/21-144);
DTL  3.22197
RID  0.338421
RPH  ((Q73W09_MYCPA/9-129:0.00096,(O33283_MYCTU/15-135:0.27333,Q49850_MYCLE/43-164:0.43903):0.14259):0.63617,(Q9A482_CAUCR/6-128:0.73523,(Q8XW86_RALSO/2-128:0.15450,Q8XW85_RALSO/2-128:0.39648):1.04317):0.19202,LIMA_RHOER/21-144:1.06329);
RTP  ((Q73W09_MYCPA/9-129,(O33283_MYCTU/15-135,Q49850_MYCLE/43-164)),(Q9A482_CAUCR/6-128,(Q8XW86_RALSO/2-128,Q8XW85_RALSO/2-128)),LIMA_RHOER/21-144);
RTL  5.07677
LNK  LIMA_RHOER/21-144:Q9ZAG3:Y18005
LNK  O33283_MYCTU/15-135:O33283:BX842580
LNK  Q49850_MYCLE/43-164:Q49850:U00019
LNK  Q73W09_MYCPA/9-129:Q73W09:AE017237
LNK  Q8XW85_RALSO/2-128:Q8XW85:AL646070
LNK  Q8XW86_RALSO/2-128:Q8XW86:AL646070
LNK  Q9A482_CAUCR/6-128:Q9A482:AE005960
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  LIMA_RHOER/21-144
ASQ  TPDEKIVLEFMDALTSNDAAKLIEYFAEDT-MYQNMPLPPAYGRDAVEQTLAGL--FTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDL
DSQ  ACTCCGGACGAAAAGATCGTTCTGGAGTTCATGGACGCACTGACCAGTAATGATGCTGCAAAACTCATTGAGTACTTTGCAGAAGACACG---ATGTACCAGAACATGCCACTCCCCCCTGCATACGGCCGCGACGCCGTCGAGCAAACTCTGGCTGGCCTG------TTCACCGTCATGAGCATCGATGCGGTGGAGACGTTCCATATCGGCTCGAGTAACGGACTTGTGTACACCGAACGTGTCGATGTCCTACGCGCACTACCCACCGGCAAGAGCTACAACCTGTCAATCCTCGGAGTCTTCCAGCTCACCGAGGGCAAGATTACGGGTTGGCGTGACTACTTCGATCTGCGCGAATTCGAAGAAGCTGTCGACCTT
TRN  11011101101011001
NAM  Q9A482_CAUCR/6-128
ASQ  PSPAQVVRAFMKAMERLDYDAAVQHLAPACEYTNPPPIGTVHGPAGVRAVLEPF--FAPTLENEFRILREATDGGLVFHERLDRHRLKDG--WVELPVTGVYEVVDGKIAYWRDYFDAQTILSQWPR
DSQ  CCGTCCCCCGCCCAGGTCGTCCGCGCCTTCATGAAGGCCATGGAGCGGCTCGACTACGACGCCGCCGTCCAGCATCTGGCGCCGGCCTGCGAGTATACGAACCCGCCGCCGATCGGCACGGTCCATGGTCCGGCCGGGGTGCGCGCGGTGCTGGAGCCTTTC------TTCGCGCCGACCCTGGAGAACGAGTTCCGGATCCTGCGAGAGGCGACAGACGGCGGGCTCGTCTTCCACGAGCGCCTGGATCGGCATCGCCTGAAGGACGGT------TGGGTCGAGTTGCCGGTGACCGGTGTCTATGAGGTCGTCGACGGCAAGATCGCCTATTGGCGCGACTATTTCGACGCCCAGACCATCCTAAGCCAGTGGCCGCGC
TRN  11011111101111111
NAM  Q73W09_MYCPA/9-129
ASQ  VANTRTVEGFLNALQDADYDAAEAALADDL-VYENVGLPTIHGRARAMKLFRRM---EDRAAFEVKIHRIAADGGAVLTERTDALIF--GPLRLQFWVCGVFEVQNGRITLWRDYFDFFDMLKATAR
DSQ  GTTGCGAACACCCGTACGGTCGAAGGATTCCTCAACGCGCTGCAGGACGCGGATTACGACGCCGCCGAGGCCGCACTGGCCGACGACCTC---GTCTACGAGAACGTCGGGCTGCCCACCATCCACGGCCGGGCCCGGGCCATGAAGCTGTTTCGCCGGATG---------GAGGACCGCGCCGCCTTCGAGGTGAAGATCCACCGCATCGCGGCCGACGGCGGCGCGGTGCTCACCGAACGCACCGATGCGCTGATCTTC------GGCCCGCTGCGGCTGCAGTTCTGGGTGTGCGGCGTGTTCGAGGTGCAGAACGGGCGAATCACGTTGTGGCGGGACTACTTCGACTTCTTCGACATGCTCAAGGCCACGGCGCGC
TRN  11011111101111111
NAM  O33283_MYCTU/15-135
ASQ  TEAIRAVEAFLNALQNEDFDTVDAALGDDL-VYENVGFSRIRGGRRTATLLRRM---QGRVGFEVKIHRIGADGAAVLTERTDALII--GPLRVQFWVCGVFEVDDGRITLWRDYFDVYDMFKGLLR
DSQ  ACCGAGGCCATTCGTGCCGTCGAGGCGTTCCTCAACGCCCTGCAGAACGAAGACTTCGACACCGTCGACGCCGCACTGGGCGACGACCTG---GTCTATGAGAACGTCGGGTTTTCCAGGATCCGCGGTGGCCGCCGCACGGCAACGCTGCTTCGCCGCATG---------CAGGGCCGCGTCGGCTTCGAGGTGAAGATCCACCGCATCGGCGCCGACGGCGCCGCGGTGCTCACCGAACGCACCGACGCGCTAATCATC------GGACCGCTGCGGGTGCAGTTCTGGGTCTGCGGCGTATTCGAGGTGGACGATGGGCGGATCACCCTGTGGCGGGACTACTTCGATGTCTACGACATGTTCAAGGGCCTCTTGCGA
TRN  10010101100011011
NAM  Q49850_MYCLE/43-164
ASQ  VENIRTVEVFLAALQDAGLRNRIRDVGRQPRVYQNVGLPTIHGRSKTITLWRKM---ADCIGFEIKIHRIAAVAIAVLCERADAVIV--GPLWMQFWVCGTFEVQNKRIMLWRNYFDLFDLFKATMR
DSQ  GTTGAAAACATTCGCACGGTCGAGGTTTTCTTGGCTGCCCTGCAGGACGCAGGATTACGAAACCGCATACGCGACGTTGGACGACAACCTCGTGTTTACCAGAACGTCGGACTGCCAACAATCCATGGCCGTAGCAAAACGATCACACTGTGGCGTAAGATG---------GCAGACTGTATCGGGTTTGAGATAAAGATCCACCGAATTGCCGCCGTGGCTATAGCCGTGCTCTGCGAACGCGCCGACGCGGTGATCGTC------GGCCCACTTTGGATGCAATTCTGGGTCTGTGGCACCTTCGAAGTGCAAAATAAGCGAATCATGTTGTGGCGGAATTATTTTGATTTGTTCGATCTGTTCAAGGCAACCATGCGA
TRN  10010101100011010
NAM  Q8XW86_RALSO/2-128
ASQ  STPIEIVTAFCATFPEDDGKAAIRRYFTPDTVWINEGISKTTGIEEAIAFLGRPNRSPSIAAVHFDILAIAADGNRVLTERLDRFVRADGSEIAAIRVMGIFEVEGDRIVAWRDYADVNAGRKITPD
DSQ  TCAACGCCTATCGAAATCGTCACTGCCTTCTGCGCTACTTTCCCAGAGGATGATGGGAAGGCTGCCATCAGGCGATATTTCACGCCGGACACGGTTTGGATCAATGAAGGGATTTCCAAAACTACGGGCATCGAAGAAGCAATCGCCTTCCTCGGGCGACCGAACAGATCGCCAAGCATCGCGGCCGTGCACTTCGACATTCTTGCCATCGCCGCGGATGGAAATCGCGTACTGACTGAGCGACTGGATCGCTTTGTACGCGCCGACGGCAGCGAGATCGCCGCGATCAGGGTAATGGGCATATTTGAAGTGGAAGGCGACCGTATCGTGGCTTGGCGTGACTATGCCGACGTCAACGCCGGGAGGAAGATCACCCCCGAC
TRN  10010101100011001
NAM  Q8XW85_RALSO/2-128
ASQ  PTPLETVSHFCAAFVEDGGRPAVRRWFTPDTRWVNEGVSATTGVDEAIAMIDGLETSMGISTVHFDVIAIAADGSRVLTERVDRFERADGAEIGRVTLMGIFKVEGEKIVEWRDYFDVNALQAFNAG
DSQ  CCGACCCCACTCGAAACTGTTTCACATTTCTGCGCGGCGTTCGTCGAAGACGGCGGAAGGCCAGCCGTGCGTCGCTGGTTCACACCTGACACCCGCTGGGTCAACGAGGGCGTATCCGCTACGACGGGAGTCGATGAGGCCATTGCCATGATCGACGGACTGGAGACATCGATGGGTATCTCGACGGTCCATTTTGATGTAATCGCGATTGCTGCCGACGGATCTCGTGTACTTACCGAAAGGGTCGACCGCTTCGAGCGGGCCGACGGCGCCGAAATCGGACGCGTGACCTTGATGGGAATCTTCAAAGTGGAGGGCGAGAAGATTGTCGAGTGGCGAGACTACTTCGATGTCAACGCCCTTCAGGCGTTCAATGCCGGC
TRN  10010101100011001
//