EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07857 - DUF1632)
FAM  PF07857
PID  DUF1632
DES  Protein of unknown function (DUF1632)
ANO  6
ALN  277
AID  0.353934
APH  ((((Q95QA2_CAEEL/57-321:0.69160,Q20583_CAEEL/8-246:0.69897):0.23404,O01810_CAEEL/6-270:0.36732):0.18799,YRR6_CAEEL/336-594:0.34710):0.33388,Q7Z5S9_HUMAN/11-263:0.51597,Q9U3C0_CAEEL/17-268:0.90571);
ATP  ((((Q95QA2_CAEEL/57-321,Q20583_CAEEL/8-246),O01810_CAEEL/6-270),YRR6_CAEEL/336-594),Q7Z5S9_HUMAN/11-263,Q9U3C0_CAEEL/17-268);
ATL  4.28256
DNO  3
DLN  831
DID  0.459907
DPH  (Q9U3C0_CAEEL/17-268:0.53622,Q7Z5S9_HUMAN/11-263:0.42923,Q20583_CAEEL/8-246:0.54603);
DTP  (Q9U3C0_CAEEL/17-268,Q7Z5S9_HUMAN/11-263,Q20583_CAEEL/8-246);
DTL  1.51148
RID  0.329242
RPH  (Q9U3C0_CAEEL/17-268:0.77125,Q7Z5S9_HUMAN/11-263:0.66711,Q20583_CAEEL/8-246:0.93952);
RTP  (Q9U3C0_CAEEL/17-268,Q7Z5S9_HUMAN/11-263,Q20583_CAEEL/8-246);
RTL  2.37788
LNK  O01810_CAEEL/6-270:O01810:
LNK  Q20583_CAEEL/8-246:Q20583:Z68227
LNK  Q7Z5S9_HUMAN/11-263:Q7Z5S9:BC054487
LNK  Q95QA2_CAEEL/57-321:Q95QA2:
LNK  Q9U3C0_CAEEL/17-268:Q9U3C0:Z70284
LNK  YRR6_CAEEL/336-594:Q10000:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9U3C0_CAEEL/17-268
ASQ  GYVALLLSCCAFGTMFVPLRRRNCKDGFFVQWIECGVVFIVGCIFYAARGFPKFEPIACIGGFLYATGNVFSVPIVEGIGMGVGFLIWTSLQIIVGWGVARFGLFQWIAPQNVKNDVLNYIGIALTIVSGVLLIFVKHVETEPENEYDVTSKEMEHQEEIEQRLSNSERDSSFDMAGLAK------------KLPYILM-------AMVLACLHGLMMSPIEYLKQQNP------PTDSFQVFDYIFPFYTSVFLFSTLYFFAYCVILRRKAYVERN
DSQ  GGATACGTGGCACTTCTTCTTTCTTGCTGCGCTTTTGGAACAATGTTTGTTCCATTGAGAAGAAGAAATTGTAAGGATGGATTTTTTGTCCAGTGGATTGAATGTGGAGTTGTATTCATTGTCGGTTGCATCTTCTACGCAGCACGTGGATTTCCAAAATTCGAGCCAATTGCGTGTATTGGAGGATTTCTTTATGCAACTGGAAATGTATTCAGTGTGCCAATTGTTGAAGGAATTGGGATGGGAGTTGGATTCTTGATTTGGACTAGTCTTCAGATTATTGTCGGATGGGGAGTGGCAAGATTCGGGCTGTTCCAATGGATTGCCCCGCAGAATGTGAAAAATGATGTGTTGAACTATATTGGAATTGCATTGACAATCGTGAGTGGAGTTCTTTTGATATTCGTGAAACACGTGGAAACGGAGCCAGAAAATGAATATGATGTGACCAGCAAGGAAATGGAACATCAAGAAGAGATTGAGCAAAGACTCAGCAATTCAGAAAGAGATTCTTCATTTGATATGGCTGGTTTGGCAAAG------------------------------------AAATTACCTTATATCCTTATG---------------------GCAATGGTTCTTGCGTGTCTACATGGTTTGATGATGTCACCGATTGAATATTTGAAGCAACAGAATCCA------------------CCAACTGATAGTTTCCAAGTGTTTGACTATATTTTCCCATTCTACACATCAGTATTCCTCTTCTCTACACTGTATTTCTTCGCGTATTGTGTAATTTTGCGTCGAAAAGCCTACGTGGAAAGGAAT
TRN  10010101100011000
NAM  Q95QA2_CAEEL/57-321
ASQ  GILACLTATFTLGSVFAPIKRFPSSDGFMVQFFMSLGGFITSLAIHALLGFPPIYPLAMLGGALWCAANAFAFLIMNRLGLAVPILIWSTVSCLTGWATTRYGLFG-VPKGIPSSVILNYIGIIVLVVGSSFFLFIKSHVYIPKKRNNSESLTSGGEIPSKKS--MATQSSEED-----DIVQHPHHVSPIVRIVFFFEFYSTQKNYLILGLFYGSMCTPVTFIQNRPD----LYPGAPTEGLPYLFSFFCGIMPMSTFVLVIYSAVKKNNPSLPSY
NAM  Q7Z5S9_HUMAN/11-263
ASQ  GYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAMLGGCIWATGNIAVVPIIKTIGLGLGILIWGSFNALTGWASSRFGWFG-LDAEEVSNPLLNYIGAGLSVVSAFIFLFIKSEIPNNTCSMDTTPLITEHVINTTQD-----PCSWVD-----KLSTVHH------RIVGCSL-------AVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDLDYVFAHFSGIFLTSTVYFLAYCIAMKNSPKLYPE
DSQ  GGTTACATCTCCTGTTTTGTAGCTATCCTTTTGTTTGGCTCAAATTTTGTGCCACTTAAAAAATTTGATACTGGTGATGGAATGTTTCTCCAGTGGGTTCTTTGTGCTGCCATATGGTTGGTTGCCTTGGTTGTCAATCTGATATTACATTGTCCAAAGTTTTGGCCTTTTGCAATGCTTGGGGGCTGCATTTGGGCAACAGGGAACATTGCTGTTGTCCCAATTATCAAAACCATTGGTTTAGGCCTTGGAATCTTAATCTGGGGATCATTTAATGCCTTAACTGGCTGGGCAAGCTCAAGGTTTGGCTGGTTTGGA---TTGGATGCAGAAGAAGTATCAAATCCGCTGCTAAATTACATTGGAGCTGGGCTATCAGTAGTAAGTGCTTTCATATTTTTGTTCATCAAAAGTGAAATACCAAATAACACGTGTTCCATGGATACCACTCCATTAATAACAGAGCATGTGATCAACACAACCCAAGAC---------------CCCTGTTCCTGGGTGGAT---------------AAACTTTCTACAGTACACCAC------------------CGCATAGTGGGCTGCAGTCTT---------------------GCAGTGATATCTGGAGTACTCTATGGATCTACATTTGTGCCAATCATCTACATCAAGGACCACAGCAAAAGAAATGATAGTATATATGCAGGGGCAAGCCAATATGATTTAGACTATGTGTTTGCGCACTTCAGTGGCATCTTTCTTACAAGTACTGTCTACTTTCTGGCCTACTGCATAGCCATGAAAAATAGTCCTAAACTATATCCTGAA
TRN  10010101100011000
NAM  YRR6_CAEEL/336-594
ASQ  GLSACALSSVLFGSMFVPVKKCHSGNGIFVQWIMSTAILLVGIVVYSTQGFPEFEPLAMLGGMFWALGNATAVPIMNTIGIGMGMLVWGTTNCVAGWAAGRFGLFG-INSTVPEYPFLNYFGLVLVVFGGFLFSQIR--PNEPQTASERSPLMVAPDDDLTDD--VAPDDSDIVVPRGGAVPTRAHRNQK--RLLAIIT-------SLVAGVFYGFTFVPVIYIQDHPE----IYPTAPKTGLGYVFSHYIGIFCTASALMIGYVIYSRNNPFASSR
NAM  O01810_CAEEL/6-270
ASQ  GLAACAVSSVFFGSMFVPIKSYDSRDGIFAQWMMSIAILLVGFIVFATTGFPGFYPLAMLGGASWCIGNATAIPIISRLGLAVSILVWNTSNCLVGWAGGRFGLFG-MKAQVPASPFLNYLGLVFVVIGGSIFAQVRSEPLPIAKKTSRTSFDLENLNSEEKKALNTTESSDDGGLETEVLRPDKNLNSGTQRFFAFIT-------AIVAGFFYGMTFVPVIRMIDNPQ----LYPFYPQDGISYVFSHYFGIFITSTIIFVIYSIFRRNQPYAPPN
NAM  Q20583_CAEEL/8-246
ASQ  GIVCAVVSAITFGSTYVPLKWFHKGDGLYFQWVQSLGQLLVGVAVAMTTAPAPIHPIAMLSGMFYSVGNSLTVFIMDGIGLAIGYLLWNTVTCVVGWAVTRFGLFA-NPQQYPKSDWLNILGVVTVCVGGAIYAPIKHIP----ARVRPAPWSLE-EDNYKDDPLVVKEVSCTR------------------RILCLFL-------TIFVGFLYGNFLTPINYIIANE-------PGSHQDVRAYILSYCLGSFVTSTVIFFVYSIVKKNVPLVNAE
DSQ  GGAATCGTGTGTGCTGTTGTTTCTGCAATCACATTCGGTTCCACTTATGTTCCATTGAAATGGTTTCATAAAGGAGATGGGTTGTATTTCCAATGGGTTCAGTCACTTGGACAGCTTTTGGTTGGAGTTGCTGTTGCAATGACAACAGCTCCAGCACCAATTCACCCTATTGCGATGTTGAGTGGGATGTTCTATTCAGTCGGAAACTCTCTGACAGTTTTCATCATGGACGGAATTGGTTTAGCAATTGGATATCTTCTCTGGAATACTGTTACTTGCGTTGTGGGCTGGGCTGTCACCCGATTTGGACTGTTTGCC---AACCCTCAACAATATCCAAAAAGTGACTGGTTAAATATTTTGGGTGTGGTTACGGTATGTGTTGGAGGAGCTATTTATGCACCGATCAAGCATATCCCC------------GCAAGAGTGAGACCTGCTCCATGGAGTTTGGAA---GAAGATAATTATAAAGATGACCCATTGGTTGTGAAGGAGGTTTCGTGCACAAGA------------------------------------------------------AGAATATTATGCCTATTCCTA---------------------ACAATTTTCGTTGGTTTCCTTTACGGCAACTTCTTGACCCCAATCAACTATATAATTGCCAATGAG---------------------CCCGGTTCACATCAAGATGTTCGTGCATACATCCTTTCTTATTGTCTTGGATCATTTGTTACATCTACTGTAATCTTCTTCGTTTACTCAATTGTAAAGAAGAACGTTCCACTTGTGAATGCGGAG
TRN  10010101100011000
//