EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07834 - RanGAP1_C)
FAM  PF07834
PID  RanGAP1_C
DES  RanGAP1 C-terminal domain
ANO  3
ALN  185
AID  0.48855
APH  (Q7SYN0_BRARE/392-573:0.69503,RGP1_HUMAN/404-586:0.34790,RGP1_XENLA/397-579:0.37228);
ATP  (Q7SYN0_BRARE/392-573,RGP1_HUMAN/404-586,RGP1_XENLA/397-579);
ATL  1.41521
DNO  3
DLN  555
DID  0.53135
DPH  (Q7SYN0_BRARE/392-573:0.52207,RGP1_HUMAN/404-586:0.34777,RGP1_XENLA/397-579:0.27178);
DTP  (Q7SYN0_BRARE/392-573,RGP1_HUMAN/404-586,RGP1_XENLA/397-579);
DTL  1.14162
RID  0.48855
RPH  (Q7SYN0_BRARE/392-573:0.69503,RGP1_HUMAN/404-586:0.34790,RGP1_XENLA/397-579:0.37228);
RTP  (Q7SYN0_BRARE/392-573,RGP1_HUMAN/404-586,RGP1_XENLA/397-579);
RTL  1.41521
LNK  Q7SYN0_BRARE/392-573:Q7SYN0:BC054654
LNK  RGP1_HUMAN/404-586:P46060:X82260
LNK  RGP1_XENLA/397-579:O13066:U88155
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q7SYN0_BRARE/392-573
ASQ  GNDAEENGLNGTKDVIEEKE---EPPHSSELMSFLVSPSAEKLISLGTKRVQLIEQQVDVTDANKVSEVFLKISSVYKDEPEVKQAVFETTDALLRKAFSNSPHSQSYSFISSLMVNLGLLKSEDKKVKKVSVLPGHLLTLEHAVSQEFFPADQAGVLESFVSRNGAVLESCCSARDALKITLVK
DSQ  GGCAATGATGCTGAGGAAAATGGTCTAAATGGAACAAAAGATGTCATTGAAGAAAAGGAG---------GAGCCTCCCCACAGTTCTGAGCTCATGTCCTTCCTCGTCTCTCCATCAGCTGAAAAACTGATCTCACTTGGAACCAAAAGAGTTCAGCTCATTGAACAGCAGGTTGATGTTACAGATGCGAATAAGGTGTCAGAAGTTTTTCTGAAGATCTCGTCAGTATATAAAGATGAGCCAGAAGTAAAGCAAGCTGTTTTTGAGACCACTGATGCCCTGTTGAGGAAGGCCTTCTCCAACTCTCCTCACTCTCAATCTTATAGTTTTATCTCCTCTCTAATGGTGAACCTGGGACTTTTAAAGAGTGAAGATAAGAAGGTGAAGAAAGTATCTGTACTGCCTGGACATTTGCTCACATTAGAGCATGCAGTCTCACAGGAGTTTTTCCCAGCGGATCAAGCTGGAGTTCTGGAATCCTTTGTGTCACGAAATGGTGCAGTCTTAGAATCCTGCTGCAGTGCCAGAGATGCTCTCAAGATCACACTGGTGAAA
TRN  10010101100011000
NAM  RGP1_HUMAN/404-586
ASQ  GEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSF-NSNTFLTRLLVHMGLLKSED-KVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYK
DSQ  GGAGAGAAGTCAGCCACGCCCTCACGGAAGATTCTGGACCCTAACACTGGGGAGCCAGCTCCCGTGCTGTCCTCCCCACCTCCTGCAGACGTCTCCACCTTCCTGGCTTTTCCCTCTCCAGAGAAGCTCCTGCGCCTAGGGCCCAAGAGCTCCGTGCTGATAGCCCAGCAGACTGACACGTCTGACCCCGAGAAGGTGGTCTCTGCCTTCCTAAAGGTGTCATCTGTGTTCAAGGACGAAGCTACTGTGAGGATGGCAGTGCAGGATGCAGTAGATGCCCTGATGCAGAAGGCTTTCAACTCCTCGTCCTTC---AACTCCAACACCTTCCTCACCAGGCTCCTCGTGCACATGGGTCTGCTCAAGAGTGAAGAC---AAGGTCAAGGCCATTGCCAACCTGTACGGCCCCCTGATGGCGCTGAACCACATGGTGCAGCAGGACTATTTCCCCAAGGCCCTTGCACCCCTGCTGCTGGCGTTCGTGACCAAGCCCAACAGCGCCCTGGAATCCTGCTCCTTCGCCCGCCACAGTCTGCTGCAGACGCTGTACAAG
TRN  10010101100011001
NAM  RGP1_XENLA/397-579
ASQ  GGDNENKEKSKEIPCLSGSAPASPPKLPVDASTFLSFPSPEKLVRMGPRRSAMIAQQVNVADTEKVVQAFIQVSSVYREDGEIKAAVEETIDGLMKEAFENRGF-QANVFITSLLVQMGLLKSED-KMKTIPHLNGPLLTLNHMVQQNYFPKSLASTLLAFISKPNGVLENNASARHTLLCNLHN
DSQ  GGAGGAGATAATGAAAACAAAGAGAAGTCCAAAGAAATTCCATGCTTAAGTGGATCAGCACCAGCTTCTCCACCTAAACTTCCTGTTGATGCATCCACCTTTCTTAGCTTTCCTTCCCCAGAGAAACTTGTGCGCATGGGTCCTAGACGTTCTGCAATGATAGCACAACAGGTCAATGTTGCAGATACAGAAAAGGTGGTCCAAGCTTTCATTCAGGTCTCCTCTGTGTATAGGGAGGATGGTGAAATAAAGGCGGCTGTTGAAGAAACTATTGATGGTTTAATGAAGGAGGCTTTTGAAAACAGAGGTTTC---CAAGCAAATGTGTTTATCACTAGTCTACTGGTGCAAATGGGACTTCTTAAGAGTGAAGAC---AAAATGAAAACAATACCACACTTAAATGGCCCTTTGCTAACTCTGAATCACATGGTACAGCAGAATTACTTCCCAAAGTCTCTTGCTTCTACTCTTCTTGCTTTCATCTCCAAGCCCAACGGTGTCCTGGAAAATAACGCCAGTGCCAGACACACATTGCTGTGCAACCTTCATAAT
TRN  10010101100011000
//