EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07830 - PP2C_C)
FAM  PF07830
PID  PP2C_C
DES  Protein serine/threonine phosphatase 2C, C-terminal domain
ANO  6
ALN  84
AID  0.40587
APH  ((Q7Q414_ANOGA/277-354:0.51108,(Q9VBF9_DROME/277-356:0.59795,Q8IMK7_DROME/278-356:0.49829):0.31435):0.24345,Q6P662_HUMAN/2-80:0.49147,(Q6NY18_BRARE/323-404:0.56988,P2CA_BOVIN/285-364:0.23816):0.14531);
ATP  ((Q7Q414_ANOGA/277-354,(Q9VBF9_DROME/277-356,Q8IMK7_DROME/278-356)),Q6P662_HUMAN/2-80,(Q6NY18_BRARE/323-404,P2CA_BOVIN/285-364));
ATL  3.60994
DNO  6
DLN  252
DID  0.486629
DPH  ((Q9VBF9_DROME/277-356:0.42563,Q8IMK7_DROME/278-356:0.29564):0.22931,Q7Q414_ANOGA/277-354:0.32727,(Q6P662_HUMAN/2-80:0.40495,(Q6NY18_BRARE/323-404:0.30184,P2CA_BOVIN/285-364:0.36536):0.15459):0.11810);
DTP  ((Q9VBF9_DROME/277-356,Q8IMK7_DROME/278-356),Q7Q414_ANOGA/277-354,(Q6P662_HUMAN/2-80,(Q6NY18_BRARE/323-404,P2CA_BOVIN/285-364)));
DTL  2.62269
RID  0.40587
RPH  ((Q7Q414_ANOGA/277-354:0.51108,(Q9VBF9_DROME/277-356:0.59795,Q8IMK7_DROME/278-356:0.49829):0.31435):0.24345,Q6P662_HUMAN/2-80:0.49147,(Q6NY18_BRARE/323-404:0.56988,P2CA_BOVIN/285-364:0.23816):0.14531);
RTP  ((Q7Q414_ANOGA/277-354,(Q9VBF9_DROME/277-356,Q8IMK7_DROME/278-356)),Q6P662_HUMAN/2-80,(Q6NY18_BRARE/323-404,P2CA_BOVIN/285-364));
RTL  3.60994
LNK  P2CA_BOVIN/285-364:O62829:AJ005457
LNK  Q6NY18_BRARE/323-404:Q6NY18:BC066779
LNK  Q6P662_HUMAN/2-80:Q6P662:BC062452
LNK  Q7Q414_ANOGA/277-354:Q7Q414:AAAB01008964
LNK  Q8IMK7_DROME/278-356:Q8IMK7:AE003770
LNK  Q9VBF9_DROME/277-356:Q9VBF9:AE003756
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8IMK7_DROME/278-356
ASQ  SIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIE----SSKITDYVDLLKCLQNRD-DIEGLPPGGGLQSKYHVIERTFKQ
DSQ  AGCATCATCATCATTGCCTTCCCCGGAGCTCCGAAGCCCACCGAGGAGGCGATAGAGGCTGAACATCGTCTGGAAAAGCAAATCGAGAAGATCACAAGAGACGAGATAGAG------------TCTAGCAAGATAACCGACTACGTGGATCTGCTGAAGTGTCTGCAGAACAGAGAC---GACATCGAAGGTCTTCCACCCGGAGGAGGTCTACAGTCCAAATATCACGTTATCGAGCGCACATTCAAGCAA
TRN  10010101100011011
NAM  Q7Q414_ANOGA/277-354
ASQ  SIIIIAFPGAPPVSEEAQKREEALEQHLRARIEQILG----EMSSIEYGALLKELARE--DIPDLPPGGGLHAKCSYVSKVFKE
DSQ  AGCATCATCATCATCGCATTTCCGGGCGCGCCGCCCGTCTCGGAGGAGGCGCAGAAGCGCGAGGAAGCGCTGGAGCAGCACCTGCGGGCCCGCATCGAACAGATACTGGGC------------GAGATGAGCTCGATCGAGTACGGCGCACTGCTGAAGGAGCTGGCCCGCGAG------GACATTCCCGACCTACCGCCCGGCGGTGGCCTACACGCCAAGTGTTCGTACGTGTCGAAGGTGTTTAAGGAG
TRN  10010111100111011
NAM  P2CA_BOVIN/285-364
ASQ  SVILICFPNAPKVSPEAVKKEEELDKYLESRVEEIIK--KQGEGVPDLVHVMRTLASE--NIPSLPPGGELASKRNVIEAVYNR
DSQ  AGTGTGATATTGATCTGTTTTCCAAATGCACCCAAAGTATCGCCAGAAGCAGTGAAGAAGGAGGAAGAGTTGGACAAATACCTGGAAAGCAGAGTAGAAGAAATCATAAAG------AAGCAGGGGGAAGGCGTCCCTGACTTAGTCCATGTGATGCGCACATTAGCGAGTGAG------AACATACCCAGCCTCCCACCAGGGGGTGAACTGGCAAGCAAGCGGAATGTAATTGAAGCCGTTTACAATAGA
TRN  10010101100011010
NAM  Q6NY18_BRARE/323-404
ASQ  TIIIICFDGAPKVTQEALQQEAELEQLIEQKVAEIIHVIRSKDEEPDLLYVMKFLASE--PIPGLPPGGGVSCKRDCIIAAYQK
DSQ  ACCATTATCATCATCTGCTTCGATGGCGCTCCCAAGGTAACGCAAGAAGCGCTGCAGCAGGAGGCTGAGCTCGAGCAGCTCATCGAGCAGAAAGTAGCAGAGATTATTCACGTGATCAGATCAAAAGACGAGGAGCCTGATCTGCTGTATGTTATGAAATTTCTGGCATCTGAA------CCCATTCCCGGCCTTCCACCAGGTGGAGGAGTCTCATGCAAGAGAGATTGCATAATTGCAGCATATCAGAAA
TRN  10010101100011001
NAM  Q6P662_HUMAN/2-80
ASQ  TCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCA---SAQKPPSLNTVFRTLASE--DIPDLPPGGGLDCKATVIAEVYSQ
DSQ  ACCTGCATCCTGGTCTGCTTCCCTGGGGCCCCTAGGCCTTCTGAGGAGGCGATCAGGAGGGAGCTAGCACTGGACGCAGCCCTGGGCTGCAGAATCGCTGAACTGTGTGCC---------TCTGCTCAGAAGCCCCCCAGCCTGAACACAGTTTTCAGGACTCTGGCCTCAGAG------GACATCCCAGATTTACCTCCTGGGGGAGGGCTGGACTGCAAGGCCACTGTCATTGCTGAAGTTTATTCTCAG
TRN  10010101100011000
NAM  Q9VBF9_DROME/277-356
ASQ  TLLLLLLPGAPKVDMDAVKAERSLDQTIVQITKEVIE----KHEIHDFETLIRLMKRMAINIPNLPPGGGLYAKYYIIEQAFHE
DSQ  ACACTGCTCCTCCTACTTTTGCCTGGAGCACCAAAGGTCGATATGGATGCAGTTAAGGCCGAAAGGAGTCTTGATCAAACTATTGTGCAAATAACCAAGGAAGTGATTGAG------------AAGCACGAAATACACGACTTTGAAACACTTATACGACTGATGAAAAGAATGGCCATTAACATTCCAAATCTACCACCTGGCGGTGGTCTTTATGCAAAATATTACATTATAGAGCAAGCTTTCCACGAG
TRN  10010101100011011
//