EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF07825 - Exc)
FAM  PF07825
PID  Exc
DES  Excisionase-like protein
ANO  2
ALN  77
AID  0.402985
APH  (Q88MN8_PSEPK/2-78:0.99785,VXIS_LAMBD/1-72:0.34703);
ATP  (Q88MN8_PSEPK/2-78,VXIS_LAMBD/1-72);
ATL  1.34488
DNO  2
DLN  231
DID  0.435185
DPH  (Q88MN8_PSEPK/2-78:0.47530,VXIS_LAMBD/1-72:0.57856);
DTP  (Q88MN8_PSEPK/2-78,VXIS_LAMBD/1-72);
DTL  1.05387
RID  0.402985
RPH  (Q88MN8_PSEPK/2-78:0.99785,VXIS_LAMBD/1-72:0.34703);
RTP  (Q88MN8_PSEPK/2-78,VXIS_LAMBD/1-72);
RTL  1.34488
LNK  Q88MN8_PSEPK/2-78:Q88MN8:AE016779
LNK  VXIS_LAMBD/1-72:P03699:J02459
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q88MN8_PSEPK/2-78
ASQ  CKVTLDEWAHDHFRTPPSSNTLRRWAREGLITPAPVKHGRSYYVEADACYREPEPLPRVPVGSPLVNRIASARYGAQ
DSQ  TGCAAAGTCACCCTCGACGAATGGGCGCACGATCACTTCAGAACGCCGCCCAGCAGCAACACTCTTCGCCGTTGGGCCCGTGAGGGCCTGATCACCCCGGCCCCGGTAAAGCACGGTCGCAGCTACTATGTTGAGGCCGATGCCTGCTACCGGGAGCCAGAGCCGCTGCCCCGCGTTCCAGTGGGCAGTCCCCTTGTTAATCGAATTGCGAGTGCACGATATGGCGCCCAG
TRN  10010101100011011
NAM  VXIS_LAMBD/1-72
ASQ  MYLTLQEWNARQ-RRPRSLETVRRWVRECRIFPPPVKDGREYLFHESAVKVDLNR----PVTGGLLKRIRNGKKAKS
DSQ  ATGTACTTGACACTTCAGGAGTGGAACGCACGCCAG---CGACGTCCAAGAAGCCTTGAAACAGTTCGTCGATGGGTTCGGGAATGCAGGATATTCCCACCTCCGGTTAAGGATGGAAGAGAGTATCTGTTCCACGAATCAGCGGTAAAGGTTGACTTAAATCGA------------CCAGTAACAGGTGGCCTTTTGAAGAGGATCAGAAATGGGAAGAAGGCGAAGTCA
TRN  10010101100011000
//